KEGG   Shewanella violacea: SVI_1238Help
Entry
SVI_1238          CDS       T01206                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
svo  Shewanella violacea
Pathway
svo00900  Terpenoid backbone biosynthesis
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SVI_1238 (dxr)
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SVI_1238 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAJ01209
UniProt: D4ZHR0
Position
1445749..1446936
Genome map
AA seq 395 aa AA seqDB search
MQKMVILGATGSIGASTLSVIGNNPEAYCIYALVANTNVDKMLALCIEHKPSIAHMVDAD
AAMLLRQRLPVNSGVEITTGAAELDDLVSSACVDTVMAAIVGAAGLLPTLAAVKAGKRVL
LANKESLVMSGSLFIDAMKASGSQVLPVDSEHNAIFQSLPESIQKNIGYCDLEGAGVSHI
LLTGSGGPFLTSPLDSLSTMTPAQACKHPNWSMGRKISVDSATMMNKGLEYIEARWLFNT
TPDQLKVVIHPQSVIHSMVQYRDGSVLAQLGNPDMRTPIAHCMSYPERINSGVEPLDFFK
VGQLSFLEPDFERFPCLSLAIEACKQGQEATTVLNAANEISVAAFLENKLKFTDIAKINE
TCLNKVSMSSLTSLDDIIALDTQTRRFALELIAKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatggtcatactcggcgcaacgggatccataggtgctagcaccttgagtgtc
attggcaacaaccctgaggcgtattgcatatatgccttggtggcaaatactaatgtggat
aagatgttggctctgtgtatagagcacaagccgtcaattgctcatatggtagatgccgat
gctgccatgctattgcgccagcgtttaccagtaaactctggggttgaaatcacaacggga
gcagctgaactagatgatctggtcagttcagcctgtgttgataccgttatggctgccatt
gttggcgccgcgggtttgctgccgacacttgccgctgttaaagcggggaagcgagtgcta
ttagcgaataaagagtccttggtgatgtctggcagcttgtttatcgacgctatgaaggcc
tccgggtcgcaggtgctgcctgtagatagcgagcataatgcgatatttcaatctttgcct
gaatcaatacagaaaaatattggttactgcgacctagaaggtgcaggagtatctcatatt
ttactgacaggttcaggggggccttttctcacttctcctctggattctcttagtaccatg
acaccggcgcaggcttgtaaacatcctaattggtctatgggtcgtaagatatccgtcgat
tcggccaccatgatgaataaggggcttgaatatattgaggcccgttggttatttaatacc
actccagaccagcttaaggttgtcatacacccccagagcgttatccactctatggttcag
taccgagatggctcagttttagctcaattgggtaacccagatatgcgcacacctatcgct
cattgcatgtcttatcccgaaagaattaactccggagttgaacctttagactttttcaaa
gtcggacagttaagctttcttgaacctgatttcgaacgattcccctgtctttctcttgcc
attgaggcttgtaagcaaggccaggaagcgacgacagtgttaaatgcagcaaatgaaata
tcggttgctgcctttttggaaaataagttaaagtttactgatatagctaaaataaatgaa
acatgtttaaacaaggtgtctatgtcctctttaacaagtttggatgatatcatcgcctta
gatacacaaacacgcagatttgctttagagttaatagcaaagatttaa

DBGET integrated database retrieval system