KEGG   Shewanella violacea: SVI_1580Help
Entry
SVI_1580          CDS       T01206                                 

Definition
(GenBank) siroheme synthase, N-terminal component, putative
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
svo  Shewanella violacea
Pathway
svo00860  Porphyrin and chlorophyll metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
Module
svo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVI_1580
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SVI_1580
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SVI_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M CysG_dimeriser Rossmann-like TrkA_N Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: BAJ01551
UniProt: D4ZIQ2
Position
1815001..1815912
Genome map
AA seq 303 aa AA seqDB search
MQYFPLFVDTSKLKVLLVGAGDVASRKLELLARTHAEILVIATDISIEVSKYAQQGRITL
IKRGVTPDDIRGVDLVYLATADDRLNAELARIADSRRIWVNVVDNPELCRFITPSIVDRG
RLQIAISTAGAAPVFARELRARLESWLPQSLTPLFDFVAEKRKEVQLKLPEFKQRKLFWE
HFFRANGDNFDDDTHVHYDNGFQGLSTAGVILLIDDETQVSLLPIAAMPLMQKLDHVFSA
EELPFILNEFVRRDAERGDLPSLSELTKLYESGQACLMYADKETVSQLKTHFPMAKHLRA
GII
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagtactttcccttatttgttgatacatccaaacttaaagtcttgttggtcggcgct
ggtgatgtggccagccgaaaattggagttattggctagaacccatgctgagattcttgtt
attgccacagacatctcaatagaggtatctaagtatgctcagcagggacgtatcacattg
attaagcgtggtgtgacacctgatgatatccgtggggttgatttagtttatcttgctact
gcagatgacaggctcaatgcagagctagcacgtattgccgatagtcgtaggatctgggtg
aatgttgtagataacccagaactttgtcgatttatcaccccatcgatagtcgacaggggg
cgcctacagatcgcaataagcacagccggtgctgcacctgtttttgctcgagaactcagg
gccaggttagagtcttggttgcctcaatctctcacgcctttgtttgattttgttgccgaa
aaacgtaaagaagtacagctaaagttacccgaatttaagcaacgtaagttattttgggaa
cacttcttcagagccaatggtgataattttgatgatgatactcacgttcattacgataac
ggctttcaaggcttgtcgacagctggagtgatcttacttatcgatgatgagactcaagtc
tctttgttacccatagctgcaatgccattgatgcagaaactggatcatgtgttcagtgct
gaagagctgcccttcattctcaatgaatttgtcaggcgagatgctgaacgcggtgattta
cccagtctgagtgaattgactaagttatacgagagtggacaagcttgtcttatgtatgct
gataaagagactgtgagccagcttaaaactcatttccctatggcgaaacatctaagggct
gggataatttaa

DBGET integrated database retrieval system