KEGG   Shewanella violacea: SVI_2807Help
Entry
SVI_2807          CDS       T01206                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
svo  Shewanella violacea
Pathway
svo00260  Glycine, serine and threonine metabolism
svo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01130  Biosynthesis of antibiotics
svo01230  Biosynthesis of amino acids
Module
svo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVI_2807 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SVI_2807 (trpB)
Enzymes [BR:svo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SVI_2807 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAJ02778
UniProt: D4ZM79
Position
3181436..3182662
Genome map
AA seq 408 aa AA seqDB search
MTKLDPYFGEYGGMYVPQILVPALKQLETAFIEAQEDEAFQAEFSDLLKNYAGRPTALTL
TRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLGLKCKVYMGAKDIERQSPNVFRMKLMGAEVIPVTSGSSTLKDACNEAMRDWSGSY
EKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQLFEREGCLPDAVIACVGGGSNAIGMF
ADFIDEESVQLIGVEPAGLGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIQESYSIS
AGLDFPSVGPQHAHLAATGRATYESATDDEALDAFQLLARCEGIIPALESSHAIAYALKF
AEKATKETILVVNLSGRGDKDIFTVADILEKREKAQLTADKESGDDRI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcgacccctacttcggcgaatatggcggtatgtacgtaccgcagatatta
gtgcctgcactgaaacagctagaaaccgcgtttattgaagctcaagaagatgaggccttt
caagccgaattcagcgacctgttgaaaaactatgccggtcgtccgacggcgctgaccttg
acccgtaacttgagtccgaacccactggtaaaaatctacctcaagcgtgaagacttgctt
cacggaggtgctcacaagaccaaccaggtcttaggccaggccctgcttgccaagcgcatg
ggtaagaaagagatcatcgccgaaactggcgcgggtcaacacggtgtagcaaccgctctc
gcctgtgccctgttaggccttaagtgcaaggtctacatgggcgctaaagacatagaacgt
cagtctcctaacgtgtttagaatgaagctaatgggcgcggaagtgattccggtcacctct
ggttcatcgacccttaaagatgcctgtaacgaagccatgcgcgactggtctggtagctat
gaaaaagctcactatctgctgggtactgccgcaggcccacatcccttccccactatagtg
cgtgaatttcagcgcatgataggcgaagagactaagaagcagctgtttgaacgtgaaggt
tgtctgcccgacgcagttatcgcctgtgtcggtggtggctcgaacgccatcggcatgttt
gccgacttcatcgatgaggaaagcgtacaacttatcggtgttgagcctgctggcctaggt
atcgatactcctatgcatggtgcgccccttaaacacggcaagacaggtatcttcttcggc
atgaaagcgccactgatgcaggacagcgaaggtcagatccaggagtcttactctatatcg
gcaggactcgacttcccatctgtgggtcctcagcatgcacatcttgcggctactggccgt
gcaacttacgagtcggcaaccgatgatgaggcactggacgccttccagctactggctcgt
tgtgaaggaattattcctgcacttgagtcatcacacgccatcgcttatgcactcaagttt
gccgaaaaagccaccaaggaaaccatcttagtggtaaatctatcgggccgcggtgataaa
gatatcttcaccgttgcggatattctggaaaagcgcgagaaagcgcaactaacagcagat
aaggagagcggcgatgaccgaatctaa

DBGET integrated database retrieval system