KEGG   Shewanella violacea: SVI_3079Help
Entry
SVI_3079          CDS       T01206                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase 1
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
svo  Shewanella violacea
Pathway
svo00640  Propanoate metabolism
svo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SVI_3079 (acnA)
Enzymes [BR:svo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     SVI_3079 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: BAJ03050
UniProt: D4ZAK5
Position
complement(3485368..3487986)
Genome map
AA seq 872 aa AA seqDB search
MNTQYRKSLPGSKLDYFDTEAAVDAISPGAYRKLPYCSRVYAENLVRRCEPAKLTDSLKQ
IIERKQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAAKGGDPSKVNPVVPTQLIVDH
SLAVEHAGFEKDAFEKNRAIEDRRNDDRFHFINWTKTAFKNIDVIQPGNGIMHQINLEKM
SPVIQSRDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRPSYMRVPDIVGV
ELVGKRQSGITATDIVLAITEFLRGEKVVSTYLEFYGEGARALTLGDRATISNMTPEFGA
TAAMFYIDEMTIDYLKLTGRDDSQVKLVENYAKQAGLWADTLKDAEYERVLHFDLSSVGR
NIAGPSNPHRRVSTSDLAKKGISGHYDMSQDADGKDLMPDGACIIAAITSCTNTSNPRNV
IAAGLIARNANAKGLTRKPWVKTSLAPGSKAVQLYLEDAKLLSELEQLGFGIVGFACTTC
NGMSGALDPVIQKEVIDRDLYTTAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTI
RFDIEKDVLGKDSQGNDVTLKDIWPSDEEIDAVIAQSVKPEQFRKVYEPMFDIKVEYGSD
NDPLYDWRPQSTYIRRPPYWEGALAGERTMKGMRPLAVLGDNITTDHLSPSNAIMLESAA
GAYLDKMGLPEVDFNSYATHRGDHLTTQRATFANPKLFNEMVTQLGKNGKAEVKQGSLTR
IEPEGIESRMWEAIETYMARKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFER
IHRTNLVGMGVLPVEFTGGNNRHSYGIDGSETYDVIGERTPGAALTLIITRKNGEQVEVP
VKCRLDTAEEVTIYEAGGILQRFAQDFLESST
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaataccgtaaatctctacccggcagtaaactcgattacttcgataccgag
gctgccgtagacgctatcagcccaggtgcataccgcaagctgccttattgctctcgtgtt
tacgccgagaacctagttcgtcgctgcgagccagctaagctgaccgactcactgaaacag
atcatcgagcgcaagcaagatctggatttcccctggtatcccgctcgcgtggtgtgtcac
gatattcttggtcagacggcgttagtcgacttggctggtctgcgtgatgccattgccgcc
aagggcggcgacccatctaaagtcaatcctgtggtgccgactcagctgattgtcgaccat
tccttagcggtggagcacgccggatttgagaaagatgccttcgagaagaaccgcgccatc
gaagacaggcgtaacgatgacagattccatttcatcaactggactaaaacggcatttaaa
aacatagatgttattcagcccggtaacggcatcatgcaccagatcaacctggaaaagatg
tctcccgttatccagtcccgcgatggggtagcatttcccgataccttagtaggaaccgac
agccacacaccacatgtcgatgcccttggggttatcgccataggtgttggcggtttagaa
gctgaaagtgtcatgctgggacgtccttcttacatgcgagtgcccgatattgtcggggtc
gagctggtgggtaaacgtcagagcgggatcaccgcgacggatatcgtgctagcgatcacc
gagtttttacggggtgagaaagtggtatcaacctatttagagttctatggcgaaggtgct
agagcgctgacattgggcgatcgcgccactatttcgaacatgaccccggaatttggtgcc
actgccgccatgttctatatcgacgagatgaccatagattatcttaagctgacaggccgg
gatgatagccaggtaaaactggttgaaaactatgccaagcaagctggcttgtgggccgat
acgctaaaagatgccgagtatgagcgagtactgcattttgacttgtcatcggttggtcgt
aacatcgccggaccttctaatccccatcgccgtgtgtcgacaagcgatcttgccaagaag
gggatcagtggtcattacgatatgagtcaagatgccgatggcaaagacttgatgccagat
ggtgcctgtatcatcgccgccatcaccagttgtactaacacgtcaaacccccgcaatgtc
attgcagcagggcttatcgcccgtaatgccaatgctaaaggcttgacccgtaagccttgg
gtgaaaacctcactggcaccgggttccaaagccgtgcagttgtatcttgaagatgccaag
ctgttgtcagaattggagcaattgggtttcggtatcgtaggtttcgcctgcaccacctgt
aacggcatgagcggcgcgttagatccagtgattcaaaaagaagtgatcgacagagacttg
tacacaacggcggtgctctcgggcaatcgaaatttcgatggtcgtatccacccctacgcc
aaacaagccttcttagcgtcacctcctctggttgtcgcctacgcgattgccggtaccatt
cgcttcgatatcgaaaaagatgtgctcggcaaagatagtcagggcaatgatgtgaccttg
aaagatatctggcccagtgacgaagagatagacgcggttattgcccaaagtgttaaacct
gagcagtttcgcaaggtctatgagcctatgttcgatattaaagtcgagtatggcagtgat
aacgacccgctatatgattggcgtccacagagtacttatatccgcaggcctccttattgg
gaaggtgcactcgcaggtgagcgcaccatgaagggcatgcgtcctctggctgtgcttggt
gacaacatcaccacagatcatctgtctccctcgaacgccatcatgctcgaaagtgccgcc
ggagcttatctggataagatgggtttaccggaagttgattttaactcctatgcgacccac
aggggcgatcatctaacgacccaacgtgctacttttgctaaccctaagctgtttaatgaa
atggtgactcagctcggtaagaatggcaaagcagaggttaagcaaggctcactcacacgc
atcgaacccgaaggcattgagtctcgcatgtgggaagctatcgaaacctatatggcgcgc
aaacagcctttgatcattatcgccggagccgattacggtcaaggttcatcacgtgattgg
gccgccaaaggcgtacgtcttgctggcgtagaggtgattgtcgccgaaggttttgagcgt
attcatcgcactaacttggtgggcatgggggtattaccggttgagtttaccggtggcaat
aaccgccattcctatggaatcgacggcagcgaaacctatgatgtgattggcgagcgcacg
ccaggggctgcattaacgctgatcatcactcgtaagaatggtgagcaggttgaagtgccg
gttaagtgccgtttagataccgcagaggaagtgacaatctatgaagcgggcgggatattg
caacgcttcgcccaggactttttagagtcttcaacataa

DBGET integrated database retrieval system