KEGG   Shewanella violacea: SVI_3103Help
Entry
SVI_3103          CDS       T01206                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
svo  Shewanella violacea
Pathway
svo00071  Fatty acid degradation
svo00072  Synthesis and degradation of ketone bodies
svo00280  Valine, leucine and isoleucine degradation
svo00310  Lysine degradation
svo00362  Benzoate degradation
svo00380  Tryptophan metabolism
svo00620  Pyruvate metabolism
svo00630  Glyoxylate and dicarboxylate metabolism
svo00640  Propanoate metabolism
svo00650  Butanoate metabolism
svo00900  Terpenoid backbone biosynthesis
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01130  Biosynthesis of antibiotics
svo01200  Carbon metabolism
svo01212  Fatty acid metabolism
svo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SVI_3103 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SVI_3103 (atoB)
   00640 Propanoate metabolism
    SVI_3103 (atoB)
   00650 Butanoate metabolism
    SVI_3103 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    SVI_3103 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SVI_3103 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SVI_3103 (atoB)
   00310 Lysine degradation
    SVI_3103 (atoB)
   00380 Tryptophan metabolism
    SVI_3103 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SVI_3103 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SVI_3103 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SVI_3103 (atoB)
Enzymes [BR:svo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SVI_3103 (atoB)
Exosome [BR:svo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SVI_3103 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAJ03074
UniProt: D4ZAM9
Position
complement(3512946..3514121)
Genome map
AA seq 391 aa AA seqDB search
MSQEIVIVAAKRTPIGGFQGALSSVPSPSLAATAIKSLVEQTGVSKDVIDEVLMGCVLPA
GLGQAPARQAALGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSADIVIAGGMESMS
LAPYLLDKARGGMRMGHGKVMDHMFLDGLEDAYTGGAMGTFAQNTADDFDITREQMDSFS
LSSLAKANKAIESGAFKQEIAPVTISSRRGDTLVDTDEQPGNARPDKIPTLRPVFAKDGT
ITAANSSSISDGAAALMLMTAQQANIQGLPILASIKGHATHAQDPSLFTTAPVGAINKLL
DKVNWSKDDVDLFEINEAFAMVTMLAISELSLDESKVNVNGGACALGHPIGCSGSRLLVT
LIYALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaagagatcgtcattgtggcagctaagcgcacccctattgggggctttcaaggg
gccttatctagcgttccatcaccttcgctggccgcaaccgccatcaagagtctggttgag
cagacaggcgtttccaaagatgtcatcgatgaagtcttaatgggttgtgtactgccagcg
ggtcttggtcaggcaccggctcgtcaagcggctctaggggcaggtttacctctgtcggtt
ggcgcaacgacagtcaataaggtctgtggatcaggaatgaagacggttatgttagcccat
gatcttatcaaggcaggcagtgccgatattgtcatagctggtggcatggaaagcatgagc
ctggcaccttatctgctcgataaagcccgcggtggcatgcgtatgggtcatggtaaggtg
atggaccatatgttcttagatggcttagaagatgcctataccggtggtgccatgggcacg
tttgcacaaaacaccgccgatgactttgacatcactcgtgagcagatggactctttttca
ctgagttcactcgctaaagccaataaggccatcgagtctggtgcattcaaacaagagata
gcgccggtcactatatcgagtcgccgtggtgataccttggtggataccgatgagcagccg
ggcaatgcacgcccagataaaattcccactctgcgtccagtctttgccaaagacggcaca
attaccgcggctaattcaagctcaatttcagatggcgcggcggcgcttatgctgatgaca
gcgcaacaggccaatattcaaggcttacctatactggcaagcatcaagggtcatgctacc
catgctcaagatccatcattgtttaccacggcacctgttggcgccataaacaagctgctc
gataaggtgaactggagtaaggatgatgtggatctgtttgagatcaacgaagcctttgcc
atggtgaccatgttggctatctccgagctctctctcgatgagtctaaggtcaacgtcaat
ggcggcgcctgtgctctggggcatcccatcggctgctcgggttcgcgtttgttagtgacc
ttgatatatgcactcaaggcccgtgggctcaagcgtggcgttgcatctctgtgtatcggt
ggcggcgaagccactgccatggcaatcgaagtttag

DBGET integrated database retrieval system