KEGG   Shewanella violacea: SVI_3687Help
Entry
SVI_3687          CDS       T01206                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
svo  Shewanella violacea
Pathway
svo00270  Cysteine and methionine metabolism
svo00480  Glutathione metabolism
svo01100  Metabolic pathways
Module
svo_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SVI_3687 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SVI_3687 (gshB)
Enzymes [BR:svo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     SVI_3687 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAJ03658
UniProt: D4ZCB3
Position
4175043..4175996
Genome map
AA seq 317 aa AA seqDB search
MIKLGIVMDPISDINIKKDSSFAMLLAAQSRGYQLFYMEMRDLAMVNGKAMANMRALSVK
QDPDNWFELGEAIDTPMSDLDVVLMRKDPPFDTEFIYATYMLERAEEEGVLIVNKPQSLR
DANEKLFTAWFSEFTPETIVTRDETRIRNFYQEKGDIILKPLDGMGGSSIFRVKKDDPNL
GVIIETLTNYGQQYAMIQAFIPDITSGDKRILVIDGEPVPYSLARIPQKGETRGNLAAGG
RGVAQPLSESDWHIARSIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIKEIEAAYDVD
ITGMLMDAIEARLKAKI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctcggcatagtgatggaccccatcagcgacattaacatcaagaaagactct
agtttcgctatgttactcgcggctcagagtcgtggatatcagctcttctatatggagatg
cgagatcttgccatggttaatggtaaggctatggccaatatgcgcgccttaagcgtcaaa
caagatcctgacaactggtttgaattaggcgaagctatcgatacgcctatgtcagatctt
gatgttgtcttgatgcgcaaagacccaccattcgataccgagtttatctacgcaacctac
atgctcgagcgagccgaagaggaaggcgtactgatcgtcaataagcctcagagcctgcgt
gacgccaatgagaaactattcaccgcctggttctccgagtttaccccggaaacgattgtg
accagagacgagacccgtatccgtaacttctatcaggaaaaaggcgatatcatactcaag
ccactcgatggcatgggcggtagctccatcttcagagtcaagaaagatgatccaaactta
ggcgtgatcattgaaacgctaactaattacggccagcaatatgccatgatccaagccttt
attcctgacatcacctcaggtgataaacgtatcttggtcatcgatggtgagccagtgccc
tattccttggctcgtatcccacaaaaaggcgagacacgaggcaacttagccgctggcggt
cgtggtgtagcccagcctctgtctgaaagtgattggcacattgcacgcagcataggtcct
gaactgaagaaacgtgggcttatcttcgtcggcctggatgtgattggcgataagcttacc
gaaatcaacgtcactagcccgacatgcatcaaagagattgaagcagcttatgatgtggac
attacaggtatgctaatggacgcaatcgaagcaaggcttaaagcgaagatttaa

DBGET integrated database retrieval system