KEGG   Shewanella violacea: SVI_3710Help
Entry
SVI_3710          CDS       T01206                                 

Gene name
lacZ
Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
svo  Shewanella violacea
Pathway
svo00052  Galactose metabolism
svo00511  Other glycan degradation
svo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SVI_3710 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SVI_3710 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SVI_3710 (lacZ)
Enzymes [BR:svo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SVI_3710 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 Glyco_hydro_72
Motif
Other DBs
NCBI-ProteinID: BAJ03681
UniProt: D4ZCD6
Position
4202841..4205936
Genome map
AA seq 1031 aa AA seqDB search
MAADRWQDHTIFEVNKEAPHASFFTYSSVSKATKDEYRNSSNFFDLNGIWQFHYAKNPQS
VPSDFASDSFDESGWSTIEVPGNWETQGYGHAIYLDERYPFTTTWPNAPTEHNPTGSYRR
VITLPENWNAKQVFFHVGAARSSFTLFVNGKEVGYSQGAKTPAEFDISDYLKAGKNLIAM
KIIRWSDASYLESQDMLRMSGIERDVYLYATEPQRVVDIDASYRLNGDLSRADMALKLKL
KNHHKEKQISLDYRVISPTGIDIAKGAKSLSLGGQKDELFNFTLKHPQLWSAETPNLYQL
IVNLRDLDGALLQSSSQKIGFRHIEIKGGQLLVNNKAITIRGVDRHETDPKTGHVVSRES
MEKDIRLMKQSNINAVRSSHYPNDPYWLRLADRYGMYIIDEANIESHPLAIDEKTQLGNE
MSWLPAHQARVERMLERDKNHASIIIWSLGNEAGEGKLFESLYHWVKQRDPSRPVQYEPA
GTQAYTDIVAPMYPSIERIEKYAKNHSDRPLIMIEYAHAMGNSVGNLQDYWDVIEQYPNL
QGGFIWDWADQSLAFTNDKGQRYWAYGKDYEPDMPTDGNFLNNGLVDPDRNPHPHLSQVK
KVYQPIGFDNFRIDGARVSLNLSNKYDFKNTAGLELNWSLQQDGLSIHTGQMKMPVIPAG
KSQTVDFQLGSEQALKLNKHYDYHLLVTARIDSPQPMLPSGHRLAFEQFEIQQASPRISK
ISHTSKISQTPDLWLLSLNENSYAISKDTGWLTRVTTGGEPQISAPLMVNFWRAPTDNDL
GNGLPEWGGIWQDAASELELESIDKVNNKGLMVTQVHPKLGFSLSTLYQLNTKGELVVNS
QFEPGNKDLADLPRFGFSTRLPFDRRFMSYFGRGPEETYADRYTGNPLGWYQLPIEKLYH
RYSRPQETGQRTQVRYAAVTNHAGSGLMAIAAKELQTSLWPFSQTDIDFRSGDAQSSASG
LVPVTRNHGAEIPIRDYVTWNIDYKQMGVGGDTSWGRQVHEPYRIKAQPMSFEFTLVPID
SSSQLQQLARD
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
ttggctgccgatcgttggcaagaccacaccatctttgaagtgaataaagaagccccccac
gccagcttttttacttacagctcggtcagcaaggccactaaagatgagtaccgtaacagt
agcaactttttcgatctcaacgggatctggcaatttcattacgccaagaatcctcaatct
gtgccatctgactttgccagcgactccttcgatgagtcaggctggagcaccattgaagtt
cccggcaactgggaaacacaaggctacggccatgccatctacctagatgaacgctatccc
ttcactacgacctggccaaatgcgccaaccgaacataaccccactggcagctaccgacgc
gtgatcaccttgcccgaaaactggaatgccaagcaggtcttcttccatgttggggcggcg
cgatcttccttcaccttgttcgtcaacggcaaggaagtgggctatagccaaggcgccaag
acccctgcagaatttgatatctctgattatttgaaagcgggtaagaatctgatcgccatg
aagatcatccgctggagcgatgccagttatcttgaaagccaagatatgctgcgtatgagt
ggcatagagagagatgtgtatctttacgccactgagccacagagagttgtcgatatcgat
gcaagttataggctcaacggcgatcttagtcgcgccgatatggcacttaaactcaagctc
aagaaccatcataaagagaagcagatatccctagattaccgagtcatctcccccactggc
attgatatcgctaaaggggctaaatcactcagtttaggcgggcagaaagatgagctgttc
aatttcaccctcaagcatccccaactgtggagcgccgagacaccaaacctgtatcagctt
atcgtcaacctaagagacctagatggagcattactccaatccagtagtcagaagataggc
tttcgccatatagagataaaaggcggccagctactggtgaacaacaaggccatcacaata
cgcggtgtcgaccgccacgaaacagatcccaaaactggtcatgtggtcagccgtgagagt
atggaaaaagacatacgcttgatgaagcaaagcaatatcaacgccgtgcgctcgagtcac
tatcctaacgatccctactggctacgactcgccgacagatatggcatgtatattatcgac
gaagccaatattgaatcccatccactggcaatcgacgagaagactcagctcggcaacgag
atgagctggctgccagcccaccaagctagggtcgagcgtatgctagagcgggacaagaat
catgcctctatcatcatctggtcattgggcaacgaggctggggaaggcaagttattcgaa
tctctttaccactgggtaaaacagcgagatcccagtcgtccggtccaatatgaaccggca
ggcacacaagcttataccgacatagtcgcgcccatgtatccgtccatagaacgcatagaa
aagtatgctaagaatcattctgatcgcccactaatcatgatcgaatatgcccatgccatg
ggcaattctgtgggtaatttgcaagactattgggatgtcatcgagcagtaccctaacctg
caaggtggctttatctgggactgggccgatcaatctctggccttcaccaatgataaaggc
caaagatattgggcctacggcaaggactatgagccagatatgcctaccgacggcaacttc
ctcaataatggcctggttgatcccgaccgcaaccctcatccacacctgagccaagtaaag
aaggtatatcagcctattggattcgataattttcgaatagatggcgccagggtaagcttg
aacctgagtaacaaatacgactttaagaacacagcgggtctggagctaaattggtcattg
caacaagatggactatcaatccacaccggccagatgaagatgccggtaattccagccgga
aagagtcaaactgtcgacttccagctcggatctgagcaagcactaaagcttaataaacac
tacgactatcatctactcgtcaccgcacgaatcgattcaccacaacccatgttgccctcg
ggtcacagactggccttcgagcaatttgagatccagcaggcttcacccaggataagcaag
ataagccacaccagcaaaattagccaaaccccagacctatggctcttgagtctcaatgaa
aatagctacgccatctctaaagataccggctggttaacccgagtcaccacaggtggagag
cctcagataagcgcccccctaatggtcaatttctggcgagcaccaacagataatgatctc
ggtaatggcctgcctgaatggggcggaatttggcaagatgcagcatctgagcttgaactc
gagtccatcgataaggttaacaataaaggccttatggtcacccaagtccatcccaaactc
ggctttagcctgagcaccctctaccagctcaatactaagggagagctagtggttaacagc
caatttgagccgggtaataaggatttagcggatctacccaggtttggctttagcactcgc
ttgcccttcgaccgacgattcatgagttacttcggccgcggtcctgaagaaacttacgcc
gaccgatacacaggcaacccacttggttggtatcaactgcctatcgaaaagttatatcac
cgctactcacgtccacaggaaacaggccagcgaactcaggttcgatacgcagccgtaact
aatcatgcaggaagcggcctgatggccatcgccgctaaagagttacaaaccagcctatgg
cccttctctcagaccgatatcgactttagaagcggtgatgctcaaagctcggcttcaggc
ttagtacctgtgacccgaaatcatggcgccgaaatccccattcgggattatgtgacctgg
aatatcgattacaaacagatgggtgtaggcggagatacctcatggggcagacaagtccat
gaaccctatcgtatcaaggcccagcccatgagtttcgaatttactcttgtgcccatcgac
tcgagtagccaactccagcagctggccagagactag

DBGET integrated database retrieval system