KEGG   Shewanella violacea: SVI_3714Help
Entry
SVI_3714          CDS       T01206                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
svo  Shewanella violacea
Pathway
svo00010  Glycolysis / Gluconeogenesis
svo00052  Galactose metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01130  Biosynthesis of antibiotics
Module
svo_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVI_3714 (galM)
   00052 Galactose metabolism
    SVI_3714 (galM)
Enzymes [BR:svo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SVI_3714 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAJ03685
UniProt: D4ZCE0
Position
4209123..4210157
Genome map
AA seq 344 aa AA seqDB search
MVRFRPLDSWTDPRGGQIERVRIDNGIIAMEVLSLGGIIRSLWTPDRHGERGNIVLGCDS
IDDYLKQDAHLGAIAGRYANRVANARMSFGEDEYLLDINQASNCLHGGTEGFNRKQWHMG
PLPDGVRLNLVSPDGDMGFPGICNVQLDYRLVGNNLYMEIFAAVNKPCPISLTQHSYFNL
EGSGSTSNAEHQLQIDSTKMLDLDAHGIPTGMKNATGSVLDFRRAKAFSMAQNHEEFVST
SGIDHCYLTDSSASELTRFGCLSAPESGRSMTLYTNQPSVQIYGANYLGGNPGKGGQALK
SHHAICIEPQQLPDAANQPTLEADPWIKPEEVYHHISRYEFHTF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtacgttttcgcccgctagactcctggacagatcctcgtggtggtcaaattgaacgt
gtcaggatagataatggcatcatagccatggaagtattgagcctaggcggaataatacgc
tccctatggactccggaccgtcatggcgagcgaggcaatatcgtacttggctgcgattca
attgacgattacctcaagcaagacgctcacttaggcgctattgctggcagatatgccaat
cgcgtagccaatgccaggatgagcttcggtgaagatgaatatttgttagatattaatcag
gcgagcaattgcctccatggtggcaccgaaggttttaatcgtaagcaatggcatatgggg
ccgctgcccgatggcgttcgtcttaatttagtcagccctgatggcgatatgggctttccg
gggatctgtaacgtacagctagattatcgattagtagggaataatctctatatggagatc
tttgccgccgtgaataagccctgccccattagcttgactcagcatagttatttcaatctt
gaaggcagcggttcaacgagtaacgcagaacatcaattacagatagacagtaccaagatg
ctagatctggacgcccatgggatccccacgggaatgaaaaatgctactggctctgtacta
gattttcgtcgagctaaggccttctccatggcccaaaaccatgaggagtttgtgtctaca
tccggaatagatcattgctacctaacggactcttcggcctcagaattaacgcgctttggc
tgtctaagcgcccctgaatctggcagaagtatgactctatataccaatcagcccagtgtg
cagatttacggagcaaattatcttgggggaaatccgggtaaaggtggacaagcattaaaa
tcacatcacgccatctgtatcgagccccagcaactaccagacgctgctaatcagcccacc
ctagaggccgatccttggataaagccagaagaggtttatcatcatatcagtcgttatgag
tttcatactttttaa

DBGET integrated database retrieval system