KEGG   Shewanella violacea: SVI_3740Help
Entry
SVI_3740          CDS       T01206                                 

Gene name
metB
Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
svo  Shewanella violacea
Pathway
svo00270  Cysteine and methionine metabolism
svo00450  Selenocompound metabolism
svo00920  Sulfur metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01130  Biosynthesis of antibiotics
svo01230  Biosynthesis of amino acids
Module
svo_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SVI_3740 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SVI_3740 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SVI_3740 (metB)
Enzymes [BR:svo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     SVI_3740 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAJ03711
UniProt: D4ZCG6
Position
complement(4242341..4243507)
Genome map
AA seq 388 aa AA seqDB search
MTERKLATIAVRQGIESDTQHGAVVPPIYLSTNYCFDGHKNPRDFDYSRSGNPTRSILGD
AIASLEKGATGIVTCTGMAAITLVTSLLGPDDLLVVPHDCYGGSYRLFTNLAKKGAFKLA
VVDQTDSAALEVAIARKPKMVWLETPSNPLLRVVDIEAISKASNLVDALVVVDNTFLSPI
LQQPLLLGADIVIHSTTKYINGHSDVVGGAVVAKDAELGELLHWWSNTLGLTGSAFDSYL
TLRGIRTLAVRIREHQANAQRILEVLTTSLAVEKVYYPGLETHPGHKIAAKQQKGFGAML
SFELKGGEKELVAFLDKLSIFSLAESLGGVESLVAVPATMTHRAMEPEARAAAGVKETLI
RLSVGIEDADDLVADVQAGLFAALAASR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgtaagttagccacaattgcagtgcgtcaagggattgaatccgatacccaa
catggtgctgtggtgccccctatctatttatcgactaattattgcttcgatggccataag
aatcctagagacttcgattatagccgttcgggtaatccgactcgatctattcttggggat
gccattgctagcctggaaaaaggcgcaactggcatagtgacttgtacaggtatggctgcg
attacattagtgactagcctgttgggtcccgatgacctgcttgtggttccccatgactgt
tatggcggtagctatcgtctgtttactaacttggctaagaagggagcgtttaagttagct
gttgtcgatcagaccgacagcgctgcactcgaagttgctattgctcgcaagcctaagatg
gtctggctggaaacaccgtctaatccactactgcgtgtcgtcgatatcgaagctatttcc
aaggcaagtaacttagtagatgccttagtggtggtcgataatacgttcctgtcgccaatt
ctacagcaacctttgcttctcggcgccgatatcgttattcactcgaccactaagtacatc
aatggccatagcgacgtagtcggtggtgccgtcgtcgctaaggatgccgagttaggtgag
ttattacattggtggtcgaataccttaggcctaactgggtcagccttcgatagttatcta
accttacgtggtattcgtacccttgcggtacgtattcgtgagcatcaggctaatgctcag
cgcatattagaagtattaaccactagtttggccgtggaaaaggtatactacccgggtctt
gaaacacatccgggtcataagattgccgcgaaacagcagaaaggcttcggtgccatgttg
agtttcgaactcaagggtggagagaaggagctggtggcattcttggataaactctctatt
ttttcactggctgaaagtttaggtggggtagaaagtttagtcgcggttcctgcgacaatg
acccacagagccatggagcctgaggctcgcgctgcagccggagtaaaagagacccttatc
cgtctgtccgtaggtatcgaagatgccgatgatttagttgccgatgttcaagccggactc
tttgcagcattagctgccagtcgttaa

DBGET integrated database retrieval system