KEGG   Shewanella violacea: SVI_3842Help
Entry
SVI_3842          CDS       T01206                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
svo  Shewanella violacea
Pathway
svo00860  Porphyrin and chlorophyll metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
Module
svo_M00121  Heme biosynthesis, glutamate => heme
svo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVI_3842 (hemD)
Enzymes [BR:svo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SVI_3842 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 SIS_2
Motif
Other DBs
NCBI-ProteinID: BAJ03813
UniProt: D4ZCR8
Position
4369753..4370481
Genome map
AA seq 242 aa AA seqDB search
MKILLTRPYGRNQLMVEALTSRSVSYLVAPLLQIEATPAKQQGDGMALFHHADIIIFIST
NAVNFATQAMKQAWPSETQFYAIGAATLNALAQLGISAQEAPQDCQQTEGLLTLPQLQSL
SNKKIVIVRGRGGREALASELIHRGGDVSYWEVYRRTCPRLSPQSNAQAWQQAKIDTIVI
TSGEILDNLIKLVPKELFAWLRACHIIVPSSRVQEQAVANGFQQVTNAKAANSKAILTAL
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattactgacccgcccatatggacgaaatcagttaatggttgaggcgctgaca
agcagaagcgtctcatatcttgttgcgcctttactgcagatagaagcgaccccggcaaaa
caacaaggtgacggcatggcgttatttcaccatgccgacatcatcatatttatcagcacc
aacgcagtaaattttgccactcaagccatgaagcaagcctggccttctgagacacagttt
tacgcaatcggtgcagcaactcttaatgcacttgcacaattgggcatttctgcccaagaa
gcacctcaagattgtcaacagaccgaaggtttactcactcttccccagctccaatctctt
tcgaacaagaaaatagtcatagtacgagggcgaggaggaagagaagcactggcaagtgag
ttaatccatagaggtggtgatgttagctactgggaagtttatcgcagaacctgcccaaga
ttatctcctcaaagcaacgcacaagcctggcaacaagccaaaattgacaccatagtcatc
accagtggcgaaattctcgataacctaatcaaacttgtaccaaaagagttatttgcttgg
ctgcgtgcatgtcatattatagtccctagctcacgagtacaggagcaggctgttgccaat
ggatttcaacaggttaccaatgcaaaggcggctaacagtaaggccatacttacagcttta
ggcttataa

DBGET integrated database retrieval system