KEGG   Streptomyces vietnamensis: SVTN_01215
Entry
SVTN_01215        CDS       T03586                                 

Definition
(GenBank) hypothetical protein
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00525  Acarbose and validamycin biosynthesis
svt01100  Metabolic pathways
svt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SVTN_01215
Enzymes [BR:svt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     SVTN_01215
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AJF63330
UniProt: A0A0B5HMK8
Position
248739..249584
AA seq 281 aa
MTRSPRVGLAGWRLPGNHFGAAALARRAGADGLQLDLGGPGRGPWLDAPGTVDRLRDDCA
AHGVELLGVAGNTLNDIGLTAPAGSRDALRARRVLVRVLDTARALGAPLAFVPSFRRSAI
DGPDDLRRTADVLAWAAREADARGLLLAGENALQPAAARALVEQVAVPSFRLVLDTYNPR
VYGVDVLALIEATHPWIAPQVHLKDGTGGVVGRELLGDGDGGVWEALAALLAHTGASPDA
LVLENDYRDGDLRRLALDIGRARVRAARAELPATAPDHPRS
NT seq 846 nt   +upstreamnt  +downstreamnt
gtgacccggtccccccgggtgggactcgccggctggcggctgccggggaaccacttcggc
gccgccgcgctggcccggcgggcgggcgccgacggcctccagctcgacctcggcggcccg
ggccgggggccgtggctcgacgctccgggcaccgtggaccggctccgtgacgactgcgcc
gcgcacggcgtggagctgctcggggtcgcgggcaacaccctcaacgacatcgggctcacg
gcaccggccggcagtcgggacgcgctgcgcgcccggcgcgtcctggtccgcgtcctggac
acggcccgggccctgggcgcgcccctggcgttcgtcccgagcttccgccgcagcgccatc
gacggcccggacgacctgaggcgcaccgcggacgtcctggcctgggcggcccgggaggcc
gacgcgcgcggactgctcctggccggcgagaacgccctgcaacccgccgccgcgcgcgcc
ctcgtggagcaggtggccgtcccctccttccggctggtgctcgacacctacaacccgcgg
gtgtacggggtcgacgtcctggcgctgatcgaggcgacgcacccgtggatcgcgccgcag
gtccacctcaaggacggcaccggcggcgtcgtgggccgggagctgctcggggacggggac
ggcggggtgtgggaggccctggccgccctcctcgcgcacacgggcgcgtcccccgacgcg
ctggtcctcgagaacgactaccgcgacggcgacctccggcgcctcgccctcgacatcggg
cgggcccgcgtccgcgccgcgcgggcggagctgccggccactgccccggaccacccaagg
agctga

DBGET integrated database retrieval system