KEGG   Streptomyces vietnamensis: SVTN_04345Help
Entry
SVTN_04345        CDS       T03586                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00450  Selenocompound metabolism
svt00970  Aminoacyl-tRNA biosynthesis
svt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SVTN_04345
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SVTN_04345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:svt01007]
    SVTN_04345
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:svt03016]
    SVTN_04345
Enzymes [BR:svt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SVTN_04345
Amino acid related enzymes [BR:svt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SVTN_04345
Transfer RNA biogenesis [BR:svt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SVTN_04345
 Prokaryotic type
   Other AARSs
    SVTN_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Laminin_EGF PepSY_2
Motif
Other DBs
NCBI-ProteinID: AJF63781
UniProt: A0A0B5HTI9
Position
complement(1010306..1011901)
Genome map
AA seq 531 aa AA seqDB search
MTDHLILAALPTPNGELHLGHLGGPFLAADALARHLRAEGHRVTTFSATDGWESYVLDAA
RREARSPEDTARDHHSRIEAALTATSCRPDVFLDVHEEEVASDHRDWHHGLAERLVERGR
VEIRRERLLTDADTGEELVACWLAGRCPDCGEEVAGYTCEACGMWFQPAHLRDPRPRHPR
GGVAVTETASAFLRLDAPVLLDMARERRVPEDYVDLIRRYLELNGHVWRLTHPLGWGIPW
TTELPPAPRQVHSTYGLGTTAMFLLAGRQHARLHGLPGNPLLPDGTARPRFTLCFGMDGA
LPLLMQLAVQEAAGIPSAPDEYRFNQFMTLDGEKFSTSRNHVIRVLDYVAAGLDPDALRF
HLARLSPGEKPTDFSPDAFAADVTVTLAGRLSLLLDACENMYGPPPCPEPVHVLGRFEEA
AARHRRAFATGDLAAAAEAVDDWLAFAAGAIDTADAPGLLAALAALAAPLMPRWADLVWN
RLEIPGTPALTTAARVLSSGTVPLASPTPGSLPRFAPVSAAEVRALTQRCH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcatctgattctggccgccctgcccacccccaacggcgaactccatctcggg
cacctcggcggccccttcctggcggccgacgcactcgcccgccacctgcgcgccgaggga
caccgcgtcaccaccttctccgccaccgacggctgggagtcgtacgtgctcgacgccgcc
cgccgtgaggcccgaagccccgaggacaccgctcgcgaccaccacagcaggatcgaggcg
gcgctgaccgcgacctcgtgccgacccgacgtgttcctcgacgtccacgaggaggaggtg
gcgtcggaccaccgcgactggcatcacgggctcgccgagaggctggtcgaacggggacgg
gtcgagatacgccgggaacgcctcctcacggacgccgacaccggagaggagctcgtcgcc
tgttggctcgccgggcgctgccccgactgcggtgaagaggtcgccgggtacacctgcgag
gcctgcggcatgtggttccagcccgcgcatctgcgcgacccgcgcccccggcacccgcgc
ggcggtgtcgctgtgaccgagaccgcctcggcgttcctccggttggacgcgccggtgctc
ctggacatggcgcgggaacgccgagtgcccgaggactacgtcgacctcatccgccgctac
ctggaactcaacgggcacgtctggcggttgacccacccgctcggctggggcatcccctgg
acgaccgaacttcccccggcacctcggcaggtccattcgacctacggcctcggaaccacc
gcgatgttcctcctggccggccggcagcacgcacgactgcacggcctaccgggcaatccg
ctgttgcccgacgggacggcccggccgcgcttcaccctgtgcttcgggatggacggggcg
ctcccgctgctgatgcagctcgccgtccaggaggccgccgggataccttccgccccggac
gagtaccgcttcaaccagttcatgacgctcgacggagagaagttctccaccagccggaac
cacgtcatccgggtgctggactacgtcgcggccggcctggaccccgacgcgctccgcttc
cacctcgcccggctcagccccggggagaagcccaccgacttctccccggacgcgttcgcg
gcggatgtcacggtgacgctggcgggacggctctccctgctgctcgacgcctgcgagaac
atgtacggaccgccaccctgcccggagccggtgcacgtcctcggccggttcgaggaggcc
gccgcgagacaccgcagggccttcgccaccggcgacctcgccgcagccgccgaggccgtg
gacgactggctggccttcgcggccggcgcgatcgacaccgccgacgcccccggcctcctc
gccgcgctggccgcactcgccgcaccgctcatgccgcgctgggccgacctggtctggaac
cggctggagatccccggtacgccggccctcaccacggcagcccgcgtgctctcctccgga
accgtgcccctggcctcgcccacccccgggagcctgccccgcttcgcgccggtgagcgca
gccgaggtacgggcgctcacccagcggtgccactga

DBGET integrated database retrieval system