KEGG   Streptomyces vietnamensis: SVTN_08940Help
Entry
SVTN_08940        CDS       T03586                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00860  Porphyrin and chlorophyll metabolism
svt01100  Metabolic pathways
Module
svt_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVTN_08940
Enzymes [BR:svt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     SVTN_08940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: AJF64534
UniProt: A0A0B5I8G5
Position
2027119..2028627
Genome map
AA seq 502 aa AA seqDB search
MRGGGLLVAGTTSDAGKSVVTAGICRWLVRQGIKVAPFKGQNMSLNSFVTREGAEIGRAQ
AMQAQAARVEPSALMNPVLLKPGSDRSSQVVLMGKPVGEMSARGYHGGRQQTLFEPVMAC
LEELRGTYDAVICEGAGSPAEINLRRTDIVNMGIARAAKLPVVVVGDIDRGGVFAQFFGT
TALLAPEDQSLVAGYLVNKFRGDVTLLEPGLDMLHGLTGRRTFGVLPYAHGLGIDEEDGL
RVSLRGTVRESVVAPPVGADVLRVAVCAVPLMSNFTDVDALTAEPGVIVRFVDRPEELAD
ADLVVVPGTRGTVKALAWLRERGLADALVRRAAEGRPVLGICGGFQALGERIEDEVESKA
GVVDGLGLLPVRVRFGVEKTLARPVGEALGEQVEGYEIHHGVADVRGGEPFLDGCRVGSV
WGTHWHGSLESDGFRRAFLREVAAAAGRRFVPAPDTSFGALREEQLDRLGDLIEEHADTD
ALLRLIEQGAPEGLPFVPPGAP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtggggggctgctcgtcgccgggaccacgtccgacgcgggcaagagcgtcgtc
acggccggcatctgccgctggctggtccggcagggcatcaaggtcgcgccgttcaaggga
cagaacatgtccctgaactccttcgtcacccgggagggcgccgagatcggccgcgcgcag
gccatgcaggcacaggccgcccgggtggagccgagcgccctgatgaacccggtgctgctc
aagcccggcagcgaccgctccagccaggtcgtcctgatgggcaagccggtcggggagatg
agcgcccgcggctaccacgggggcaggcagcagacgctcttcgagccggtgatggcgtgc
ctggaggaactccggggcacgtatgacgccgtgatctgcgagggggcggggagtccggcc
gagatcaacctgcggcgcacggacatcgtgaacatgggcatcgcgcgcgccgcgaagctg
cccgtcgtcgtggtcggggacatcgaccggggcggggtcttcgcccagttcttcgggacg
acggcgctgctcgcgccggaggaccagtcgctggtggcgggctacctcgtgaacaagttc
cggggcgacgtgacgctccttgagccgggtctcgacatgctgcacgggctcaccgggcgc
cggaccttcggtgtcctgccgtacgcgcacgggctcggcatcgacgaggaggacggcctg
cgggtctcgctgcggggcaccgtccgcgagtcggtcgtcgcgccgccggtcggcgcggac
gtgctgcgggtcgcggtctgcgcggtcccgctgatgtcgaacttcaccgacgtggacgcg
ctgacggcggagccgggtgtgatcgtgcggttcgtggaccggccggaggagctggccgac
gcggatctcgtggtcgtgccgggcacccggggcacggtcaaggccctcgcctggctgcgc
gagcggggcctcgcggacgccctcgtccggcgcgcggccgagggccggccggtgctcggc
atctgcggcggcttccaggcgctcggcgagcgcatcgaggacgaggtcgagtcgaaggcc
ggtgtcgtggacgggctcgggctgctgcccgtacgggtgcggttcggggtcgagaagacc
ctcgcccggccggtcggcgaggcgctcggcgagcaggtcgaggggtacgagatccaccac
ggcgtcgccgacgtgcggggtggtgagccgttcctcgacggatgccgggtcggctccgtg
tggggcacccactggcacggctcgctggagagcgacgggttccggcgggcgttcctgcgg
gaggtcgcggcggcggcgggacgacggttcgtaccggcccccgacacctcgttcggcgca
ctgcgcgaggagcagctcgaccggctcggcgacctgatcgaggaacacgcggacacggac
gctctgctgcggctgatcgagcagggcgctccggaggggctgccgttcgtgccgccgggt
gcgccgtga

DBGET integrated database retrieval system