KEGG   Streptomyces vietnamensis: SVTN_18780Help
Entry
SVTN_18780        CDS       T03586                                 

Definition
(GenBank) beta-ACP synthase
  KO
K05551  minimal PKS ketosynthase (KS/KS alpha) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00253  Tetracycline biosynthesis
svt01056  Biosynthesis of type II polyketide backbone
svt01100  Metabolic pathways
svt01110  Biosynthesis of secondary metabolites
Module
svt_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SVTN_18780
   00253 Tetracycline biosynthesis
    SVTN_18780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:svt01004]
    SVTN_18780
   01008 Polyketide biosynthesis proteins [BR:svt01008]
    SVTN_18780
Enzymes [BR:svt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     SVTN_18780
    2.3.1.260  tetracycline polyketide synthase
     SVTN_18780
    2.3.1.-  
     SVTN_18780
Lipid biosynthesis proteins [BR:svt01004]
 Polyketide synthase
  Component type
   SVTN_18780
Polyketide biosynthesis proteins [BR:svt01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     SVTN_18780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N XdhC_C DUF2148
Motif
Other DBs
NCBI-ProteinID: AJF66132
UniProt: A0A0B5I6X1
Position
complement(4211522..4212787)
Genome map
AA seq 421 aa AA seqDB search
MTRRVVITGVGVRAPGGSGTKEFWDLLTAGRSATRPISFFDAAPFRSRIAGEVDFDARAE
GFSPREVRRMDRATQFAVACTREALADSGLETGALDPSRIGVALGSAVASATSLENEYLV
MADAGREWVVDPAHLSPYMFDYLSPGVMAAEVAWAAGAEGPVTMVSDGCTSGLDSVGYAV
QLIREGSVDVAVAGAADTPVSPIVVACFDAIKATTPRNDDPEHASRPFDGTRNGFVLAEG
AAMFVLEEYEAAKRRGAHIYAEVGGYATRCNAYHMTGLKKDGREMAESIRAALDEARLDR
TAVDYVNAHGSGTKQNDRHETAAFKRSLGDQAYAVPVSSIKSMVGHSLGAIGSIEIAASI
LAIEHNVVPPTANLHNPDPECDLDYVPLTARELRVDTVLTVGSGFGGFQSAMVLHRPEVA
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgacgcgtagtgatcaccggggtcggggtgcgcgcccctggcggctcggggacg
aaggagttctgggacctgctcaccgcgggccgctcggccacccggcccatcagcttcttc
gacgccgctccgttccggtcccggatcgcgggcgaggtcgacttcgacgcgcgggccgag
ggcttctcgccgcgcgaggtccggcgcatggaccgcgccacccagttcgccgtcgcctgc
acccgggaggcgctcgccgacagcggcctggagacgggcgcgctcgatccctcccggatc
ggcgtcgccctgggcagtgccgtcgcctccgcgaccagcctggagaacgagtacctcgtg
atggcggacgccggccgtgagtgggtggtggatccggcgcacctgtcgccgtacatgttc
gactacctcagcccgggggtcatggccgccgaggtcgcctgggcggccggcgccgagggg
ccggtcaccatggtgtccgacggctgcacctcgggtctggactcggtcggctacgccgtc
cagctgatccgcgagggcagtgtggacgtggcggtcgcgggtgcggccgacacccccgtc
tccccgatcgtcgtcgcctgcttcgacgccatcaaggcgacgactccccgcaacgacgac
ccggagcacgcctcccggcccttcgacggcacccgcaacggcttcgtcctcgccgagggc
gccgccatgttcgtcctcgaggagtacgaggccgccaagcggcgcggggcgcacatctac
gccgaggtcggcggctatgccacgcgctgcaacgcgtaccacatgacgggtctgaagaag
gacggccgcgagatggccgagtccatccgggcggccctcgacgaggcccgtctcgaccgc
accgccgtcgactacgtcaacgcgcacggctccggcacgaagcagaacgaccgccacgag
acggccgcgttcaagcgcagcctcggcgaccaggcgtacgcggtgcccgtcagctccatc
aagtccatggtgggccactcgctcggtgcgatcggctccatcgagatcgccgcgtcgatc
ctggccatcgagcacaacgtcgtcccgccgacggcgaacctgcacaaccccgaccccgag
tgcgacctggactacgtgccgctcaccgcgcgtgagctgcgcgtcgacaccgtcctcacg
gtgggcagcggcttcggcgggttccagagcgcgatggtcctgcaccgcccggaggtggcc
gcatga

DBGET integrated database retrieval system