KEGG   Streptomyces vietnamensis: SVTN_18835
Entry
SVTN_18835        CDS       T03586                                 

Definition
(GenBank) hydrolase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
svt  Streptomyces vietnamensis
Pathway
svt01057  Biosynthesis of type II polyketide products
svt01100  Metabolic pathways
svt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SVTN_18835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:svt01008]
    SVTN_18835
Enzymes [BR:svt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     SVTN_18835
Polyketide biosynthesis proteins [BR:svt01008]
 Polyketide tailoring proteins
  Oxygenase
   SVTN_18835
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_N
Other DBs
NCBI-ProteinID: AJF69847
UniProt: A0A0B5IH47
Position
4223324..4224424
AA seq 366 aa
MVVAAAGVAKIAAEHARDAERDRRLAPEVVRSMLDAGFARHFVPRRHGGGSGTFEEIVRA
VSVVGEGCTSAAWAASLTASLGRMAAYLPEEGQRRIWAGGPDALIVGALMPLGRARREEG
GWRIGGTWPYVSVVDYADWALVCAMTTEDRPTARFFAVPRGDWRTEDTWSSVGMRGTGSN
TLSVEGVFVPDELTFTRDAIAGGVAEGGDAPCHRVPLKAVNGLCFAAPVLGAARAALAAW
REGTAPRHTSASGGLDSAAAVVLGRAAGEADAAALLLEAAARAADSGEVTAFDVARSGRD
CALAAELATSAVDRLFASAGTRAHQDAAPLQRHWRDAHTASGHVVLAFSAAAESYARELH
PPQPAN
NT seq 1101 nt   +upstreamnt  +downstreamnt
gtggtggtcgcggccgccggtgtcgcgaagatcgccgcggagcacgcgcgggacgccgag
cgtgatcgccggctcgccccggaggtggtgcggtccatgctggacgccggtttcgcgcgc
catttcgtaccgcgtcggcacggcggcgggtccgggaccttcgaggagatcgtgcgggcg
gtgtccgtggtcggcgagggctgcacctcggccgcctgggcggcgtcgctgaccgcctcc
ctcggccggatggccgcctaccttcccgaggagggacagcggcggatctgggcagggggc
ccggacgccctgatcgtgggcgcgctcatgccgctgggccgggcccggcgtgaggagggc
ggctggcggatcggcggcacctggccgtacgtgagcgtcgtggactacgcggactgggcg
ctggtgtgcgcgatgacgaccgaggaccggccgaccgcccggttcttcgccgtgccgcgc
ggcgactggcgcaccgaggacacgtggtcgtcggtcgggatgcgcgggaccggcagcaac
acgctgtcggtggagggggtgttcgtgccggacgagctgaccttcacccgtgacgccatc
gccggcggtgtcgccgagggcggggacgcgccctgccaccgtgtgcccctcaaggccgtc
aacgggctgtgcttcgcggcccctgtcctcggcgccgcgcgggccgccctggcggcctgg
cgggagggcacggcaccccgccacacctcggcgtccggcggtctggacagtgcggcggcg
gtcgtcctcggccgcgcggcgggcgaggcggacgcggcggcgctgctcctggaggcggcg
gcccgtgccgccgacagcggagaggtcaccgccttcgacgtggcccgcagcggccgggac
tgcgcgctcgcggccgaactcgccacgtccgccgtggaccgcctgttcgcctccgcgggg
acccgcgcccaccaggacgcggccccgctccagcgccactggcgggacgcgcacacggcg
tccggccacgtggtgctggccttctccgccgcggccgagtcgtacgcccgcgaactccac
ccgccgcagcccgcgaactga

DBGET integrated database retrieval system