KEGG   Streptomyces violaceoruber: B1H20_02970Help
Entry
B1H20_02970       CDS       T05124                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00480  Glutathione metabolism
svu00590  Arachidonic acid metabolism
svu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    B1H20_02970
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B1H20_02970
Enzymes [BR:svu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     B1H20_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ARF60464
UniProt: A0A1V0U5E3
Position
679459..679947
Genome map
AA seq 162 aa AA seqDB search
MTLHDIPLRTLTGEPTTLGAYSGRTVLVVNVASKCGLTPQYEGLERLQQNYGDRGLTVLG
VPCNQFAGQEPGSAEEIQTFCSTTYGVSFPLLEKTDVNGGDRHPLYAELTKLADADGEAG
DVQWNFEKFVISPAGEPVARLRPRAEPESTEVVAAIEAHLPG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcacgacattccgctgcgcaccctcacgggcgagccgacgacgctgggcgcg
tacagcggccggaccgtcctggtggtcaacgtggcctccaagtgcgggctcaccccgcag
tacgagggcctggagcggctgcagcagaactacggggaccggggcctgaccgtgctcggc
gtcccgtgcaaccagttcgccgggcaggagccggggagcgcggaggagatccagaccttc
tgctcgaccacgtacggggtcagcttcccgctgctggagaagaccgacgtcaacggcggc
gaccggcacccgctgtacgcggagctgacgaagctggcggacgcggacggggaggccggg
gacgtccagtggaacttcgagaagttcgtgatctcgccggccggtgagccggtggcccgg
ctccggccgcgtgcggagccggagtccacggaggtagtcgcggcgatcgaggcgcatctg
ccgggctga

DBGET integrated database retrieval system