KEGG   Streptomyces violaceoruber: B1H20_03210Help
Entry
B1H20_03210       CDS       T05124                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00790  Folate biosynthesis
svu01100  Metabolic pathways
svu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B1H20_03210
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1H20_03210
Enzymes [BR:svu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B1H20_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N
Motif
Other DBs
NCBI-ProteinID: ARF60509
UniProt: A0A1V0U5M4
Position
724624..726216
Genome map
AA seq 530 aa AA seqDB search
MSYRPHRPRVPSPGRRAVLRGSLIAPAAVALTPATAGAAPALHLAGRPEASWGVQAGSVT
SSSALLWVRSDRPARMLVETSATESFRRVRRWHGPSIGPGTDYTGTTPLYGLPPGEQVHY
RVTLADPADPRRTGKPVYGTFRTAPARRRAGVRFLWSGDIAGQGWGINPETGGYRVYEEM
RRLDPDFFLCSGDSVYADGPLEESVTLPDGRIWRNVMTEEKAKVAETLEEYRGNFRYNLL
DRNVRRFNAQVPSVVQWDDHEVRNNWYPGQILDDARYTEKNVDILAARSVRAFHEYVPLA
PSYGSGRRSRMYRVVHHGPLLDVFVLDMRSYRNANSPGRQADDTTGILGAEQARWLKRAL
AASRAEWKVIAADMPLGLVVPDGATDFEAVAQGDPGAPLGRELQIAELLRFIKHRGITGT
VWLTADVHYTSAQHYAPERAAFKDFAPFWEFVSGPLAAGGFPANALDGTFGPDRVFVRAP
ERANVSPMESPQYFGEVEIDGDSAELTVRLRAEGGSVLFTKVLRPGRVGQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccgtccgcaccgcccgcgtgttccctcgcccggccgccgcgcggtcctgcgc
ggttcgctgatcgccccggcggcggtcgccctcacgcccgcgacggccggggcggccccc
gcgctgcacctggccgggcgtcccgaggcgtcgtggggggtgcaggccgggagcgtcact
tcctcctcggcgctgctgtgggtccgctcggaccggccggcgcggatgctggtggagacc
tcggcgaccgagtcgttccgccgggtgcgccggtggcacgggccgtcgatcggaccgggg
acggactacaccggcaccactccgctgtacggcctgcccccgggcgaacaggtgcactac
cgggtgacgctcgccgacccggccgatccgcgccgtaccggaaaaccggtctacgggacc
ttccgcaccgctccggcccgccgccgggccggggtgcggttcctgtggtcgggcgacatc
gcggggcagggctggggcatcaacccggagaccggcggctaccgggtgtacgaggagatg
cgccgcctggacccggacttcttcctgtgcagcggtgacagcgtctacgcggacggtccg
ctggaggagagcgtcacgctgccggacggccggatctggcggaacgtgatgaccgaggag
aaggcgaaggtcgccgagacgctggaggagtaccggggcaacttccgctacaacctgctc
gaccgcaacgtccgccggttcaacgcgcaggtgccctccgtcgtgcagtgggacgaccac
gaggtgcgcaacaactggtacccgggccagatcctggacgacgcccggtacaccgagaag
aacgtggacatcctggcggcacgctccgtgcgcgccttccacgagtacgtgccgctcgcc
ccctcgtacggttccgggcggcgctcccgcatgtaccgggtggtccaccacgggccgctg
ctcgacgtgttcgtgctcgacatgcgctcgtaccgcaacgccaactcccccgggcggcag
gccgacgacacgacgggcattctcggggccgagcaggcgcggtggctcaagcgcgcgctc
gcggcctcccgggcggagtggaaggtgatcgccgcggacatgccgctcgggctggtggtg
ccggacggggcgacggacttcgaggcggtggcgcagggcgaccccggggcgccgctgggg
cgggagctccagatcgccgaactgctgcggttcatcaagcaccgcgggatcaccgggacg
gtgtggctgacggcggacgtgcactacacctcggcccagcactacgcaccggagcgggcg
gcgttcaaggacttcgccccgttctgggagttcgtgtccggccccctggcggcgggcggc
ttcccggccaacgcgctggacggcaccttcggtccggaccgggtcttcgtacgggctccc
gagcgggcgaacgtctcgccgatggagtcgccgcagtacttcggggaggtggagatcgac
ggcgacagcgcggagctgacggtgcgtctgcgggccgagggcgggtcggtgctgttcacg
aaggtcctccggccgggccgcgtcggccagtga

DBGET integrated database retrieval system