KEGG   Streptomyces violaceoruber: B1H20_15520Help
Entry
B1H20_15520       CDS       T05124                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Organism
svu  Streptomyces violaceoruber
Brite
KEGG Orthology (KO) [BR:svu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1H20_15520
Enzymes [BR:svu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.413  A-factor type gamma-butyrolactone 1'-reductase (1S-forming)
     B1H20_15520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase ATP-synt_ab 3HCDH_N GDP_Man_Dehyd THF_DHG_CYH_C DFP
Motif
Other DBs
NCBI-ProteinID: ARF62645
UniProt: A0A1V0UBM1
Position
3596225..3596995
Genome map
AA seq 256 aa AA seqDB search
MRPGGPLLAGKVALITGASSGIGAAAARLFADEGAAVVLVARRAERIEEAAERIRKDGGR
AAAVPGDVTRRADMDRAVAVAAERFGRLDCAFNNAGHASAGTLLHELSDDEFDRTLDVNL
RGVWNCLRAQLPALLAAGGGAIVNTSSVAGVRATSASAPYVAAKHAVLGLTRAAAAEYGE
YGIRVNALVVGSTDTEMMDGVLAGGPAVRAGFGGKAIQRRLADPVEIARTAAWLCSDASS
FTTGAALAVDGGRTAV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgagaccgggcggaccgctgctggccggcaaggtcgcgctgatcaccggcgcctccagc
ggcatcggcgccgccgcggcccggctcttcgcggacgagggcgcggccgtcgtcctggtg
gcccgccgggcggagaggatcgaggaggccgccgagcggatcaggaaggacggcggccgg
gccgcggccgtaccgggcgacgtcacgcgccgggcggacatggaccgcgcggtcgccgtg
gccgcggaacggttcggccgcctcgactgcgccttcaacaacgccggccacgcgagcgcc
ggaacgctcctgcacgagctgtccgacgacgagttcgaccggaccctcgacgtcaacctg
cgcggggtgtggaactgcctgcgcgcccagctccccgccctgctggcggccggcggcggc
gcgatcgtcaacacctccagcgtcgccggggtgcgcgccacctccgcgtccgcgccctac
gtggcggcgaagcacgcggtgctcggcctgacccgggcggccgccgccgagtacggcgag
tacggcatccgggtcaacgcgctcgtggtgggcagcaccgacacggagatgatggacggc
gtcctcgcgggcgggcccgccgtccgcgccggcttcggcggcaaggcgatccagcggcgt
ctcgccgacccggtcgagatcgcccgcaccgccgcctggctctgctcggacgcctcgtcg
ttcaccacgggggccgccctcgccgtggacggcggccgcaccgccgtatga

DBGET integrated database retrieval system