KEGG   Streptomyces violaceoruber: B1H20_16305Help
Entry
B1H20_16305       CDS       T05124                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00450  Selenocompound metabolism
svu00970  Aminoacyl-tRNA biosynthesis
svu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B1H20_16305
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B1H20_16305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:svu01007]
    B1H20_16305
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:svu03016]
    B1H20_16305
Enzymes [BR:svu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B1H20_16305
Amino acid related enzymes [BR:svu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B1H20_16305
Transfer RNA biogenesis [BR:svu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B1H20_16305
 Prokaryotic type
   Other AARSs
    B1H20_16305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF1659
Motif
Other DBs
NCBI-ProteinID: ARF62778
UniProt: A0A1V0UCS7
Position
3766163..3767776
Genome map
AA seq 537 aa AA seqDB search
MAATGSEKQAAKAYYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDE
HGQKIMRTAEANDVTPQAWADKLVEEAWKPLWEHLNIANDDFIRTTETRHTDRVQEFVQD
LYDKGEIYKGGYEGPYCVGCEEYKLPGDLIDGEGDFAGQKLCPIHKKPVELLKEENYFFK
LSAYGPKLLEFYAANPDFIQPESARNEVVNFVEQGLQDLSISRSTFDWGVPVPWDDQHVI
YVWVDALLNYATAVGYGADQEKFDATFPADVHLIGKDILRFHSVIWPAMLMAQGLPLPGK
VVANGWLMVGGEKMSKSNLTGIKPQDLTAHFGVDAYRWYFLRAIAYGSDGSFSWEDFSAR
YTSELANDYGNLASRVAAMVGKYFGGVLPADTAAGDAELAVREGLAKAVATADRKIGEEL
DFQAGILAVFDFVKQVNGYITEQEPWKVAKDTTPEGQARLAAVLYTAAESLRGVAVLLNP
VMPETSQRLWDSLGAEESLGALADQRVQDAGTWGALPAGATVTKGAVLFPRLEEKPA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactggatccgagaagcaggcggcgaaggcgtactacgtctcgacccccatc
tactacgtcaacgacgctcctcacctgggccacgcctacacgaccgtcgcaggcgacgtg
ctcacgcgctggcaccgccagcgtggcgagaaggtgtggtatctcaccggcacggacgag
cacggtcagaagatcatgcgcacggccgaggcgaacgacgtcaccccgcaggcatgggcg
gacaagctcgtcgaggaggcgtggaagcccctctgggagcacctgaacatcgccaacgac
gacttcatccggaccacggagacgcggcacaccgaccgggtgcaggagttcgtgcaggac
ctgtacgacaagggcgagatctacaagggcggctacgagggcccgtactgcgtgggctgc
gaggagtacaagctccccggcgacctgatcgacggcgagggcgacttcgccgggcagaag
ctgtgcccgatccacaagaagccggtggagctcctcaaggaggagaactacttcttcaag
ctcagcgcgtacggtccgaagctgctggagttctacgcggcgaacccggacttcatccag
cccgagtcggcgcgcaacgaggtcgtgaacttcgtcgagcagggcctccaggacctgtcg
atctcgcgctccaccttcgactggggcgtcccggtcccgtgggacgaccagcacgtgatc
tacgtgtgggtcgacgcgctgctcaactacgccacggccgtcggctacggcgccgaccag
gagaagttcgacgccacgttcccggccgacgtgcacctgatcggcaaggacatcctccgc
ttccactcggtgatctggccggccatgctgatggcccaggggctgccgctccccggcaag
gtcgtcgccaacggctggctgatggtcggcggcgagaagatgtcgaagtcgaacctgacc
ggcatcaagccgcaggacctgaccgcgcacttcggtgtggacgcctaccgctggtacttc
ctgcgggccatcgcctacggcagcgacggatcgttctcctgggaggacttctccgcccgc
tacacctccgagctggccaacgactacggcaacctcgcctcgcgcgtggcggcgatggtc
gggaagtacttcggcggcgtgctgccggcggacacggccgccggcgacgccgagctggcc
gtgcgggaggggctggcgaaggccgtcgcgaccgccgaccggaagatcggcgaggagctg
gacttccaggccggcatcctggccgtcttcgacttcgtgaagcaggtcaacggctacatc
acggagcaggagccatggaaggtggccaaggacaccactccggagggccaggcccgtctg
gcggccgttctctacacggcggcggagtcgctgcgcggggtcgcggtcctgctcaacccg
gtcatgccggagacctcgcagcggctctgggactccctgggcgccgaggagtccctgggc
gcgctggccgaccagcgggtccaggacgcgggaacgtggggcgccctgcccgcgggcgcg
acggtgacgaagggcgcggtgctgttcccgcgcctggaggagaagccggcgtaa

DBGET integrated database retrieval system