KEGG   Streptomyces violaceoruber: B1H20_16500Help
Entry
B1H20_16500       CDS       T05124                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00010  Glycolysis / Gluconeogenesis
svu00020  Citrate cycle (TCA cycle)
svu00620  Pyruvate metabolism
svu01100  Metabolic pathways
svu01110  Biosynthesis of secondary metabolites
svu01120  Microbial metabolism in diverse environments
svu01130  Biosynthesis of antibiotics
svu01200  Carbon metabolism
Module
svu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B1H20_16500
   00020 Citrate cycle (TCA cycle)
    B1H20_16500
   00620 Pyruvate metabolism
    B1H20_16500
Enzymes [BR:svu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B1H20_16500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ARF62813
UniProt: A0A1V0UC52
Position
complement(3815570..3817114)
Genome map
AA seq 514 aa AA seqDB search
MAQVLEFKLPDLGEGLTEAEIVRWLVEVGDVVAIDQPVVEVETAKAMVEVPCPYGGVVTA
RFGEEGTELPVGAPLLTVAVGATESSSSLGTAADQAGPRASRNGGAVADGSAAGAGPDSG
SGSASGSGSGNVLVGYGTGAPAARRRRIRPQPTALNGTPAAASASASGSTAPGPVVAGPL
TGSASATAGPVAGAAPVTALAGEVDGREGPVAVVSPLVRRLARQHEIDLRRLTGSGPDGL
ILRADVDAAIRLAEEAAEAESRSADAPARRAVPERTTAGEPAAERVPLRGVRGAVADKLS
RSRTEIPDATCWVDADATELMAVRAAMNAATGPSAGPKVSVLALLARICTAALARYPELN
STVDTEAREIVRLPGVHLGFAAQTERGLVVPVVRDAHTRNAESIGAEIARLTELARTGKL
SPAQLTGGTFTLNNYGVFGVDGSTPIINHPEAAMLGVGRIMPKPWVHQGELAVRQVVQLS
LTFDHRVCDGGTAGGFLRYVADCVEQPAVLLRTL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggtgctcgagttcaagctgccggacctcggtgaggggctgaccgaggcggag
atcgtccgctggctggtggaggtgggcgacgtcgtcgccatcgaccagcccgtcgtcgag
gtcgaaacggccaaggccatggtggaggtgccctgcccgtacgggggcgtggtgaccgcg
cgcttcggcgaggagggtacggaactcccggtcggcgcgccgctgctgaccgtcgcggtg
ggcgcgacggagtcctcgtcctccctcggcaccgctgccgaccaggccggtccccgggcg
tcccggaacggcggggccgtcgcggacggttctgccgccggtgcaggaccggattccggt
tccggttcggcttccggttccggttcggggaacgtgctcgtggggtacgggacgggggcc
ccggccgcccggcgccgccgcatccggccgcagccgaccgccctcaacggcacgccagcc
gccgcgtcggcatccgcttcggggtctactgcccccgggcccgtcgtcgccggacccttg
accggttccgcttccgcgaccgccgggccggtggccggtgccgctccggtgaccgccttg
gccggtgaggtggacggcagggagggcccggtggccgtcgtgtcgccactcgtacgccgg
ctggcccggcagcacgagatcgatctgcggcgtctgacgggctcgggtcccgacgggctg
atcctgcgggccgatgtcgacgccgcgatccggctggcagaggaggcggcggaggcggag
agccgttcggccgacgcgcctgcccggcgggctgttccggagcggacgaccgcgggcgag
ccggccgccgagcgcgttccgctgcggggggtgcgcggagcggtcgcggacaagttgtcg
cgcagccgcaccgagatcccggacgccacgtgctgggtcgacgccgacgccaccgaactg
atggcggtcagggccgcgatgaacgcggcgacgggcccgtccgcagggccgaaggtgtcg
gtcctggccctgctggcgaggatctgcacggcggcgctcgcccggtaccccgagctgaac
tccacggtggacacggaggctcgggagatcgtccggctgcccggcgtgcacctcgggttc
gcggcccagaccgagcggggcctcgtcgtcccggtcgtccgggacgcgcacacccgcaac
gccgagtcgatcggggcggagatcgcccggctgaccgagctggcccggaccgggaagctc
agcccggcccagctcaccgggggcacgttcacgctcaacaactacggggtgttcggggtc
gacggttcgacgccgatcatcaaccacccggaggcggccatgctcggcgtcggccggatc
atgcccaagccctgggtgcatcagggggagctggccgtgcgtcaggtcgtccagctgtcg
ctcaccttcgaccaccgggtctgcgacggcggtacggcgggcggcttcctccggtacgtg
gcggactgcgtggaacaaccggcggttctgctgcgcacgctgtag

DBGET integrated database retrieval system