KEGG   Streptomyces violaceoruber: B1H20_18810Help
Entry
B1H20_18810       CDS       T05124                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
svu  Streptomyces violaceoruber
Brite
KEGG Orthology (KO) [BR:svu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B1H20_18810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ARF63193
UniProt: A0A1V0UD64
Position
4315245..4316243
Genome map
AA seq 332 aa AA seqDB search
MDTFALIVTIGVALGFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGQG
VAKTVSEGLIATPVGQKGMGILFAALVGAIIWNLITWYYGLPSSSSHALFGGMVGAALAG
GTDVIWSGVVEKIVIPMFLSPVIGLVVGYLVMVGIMWMFRKANPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGIVVMALVIADVEGPNDEIPVWVKIACAVMLSLGTYAGGWRIMRT
LGRKIIELDPPQGFAAETTGASIMFGSAFLFHAPISTTHVITSAIMGVGATKRVNAVRWG
VAKNIILGWFITMPAAALVAALSYGAVLLLFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggacacctttgcgctgatcgtgaccatcggtgtcgcgctcggcttcacgtatacgaac
ggcttccacgactcggcgaacgccatcgccacctcggtctccacccgggcgctgaccccg
cgggcggccctggcgatggcggcggtgatgaacctcgccggcgccttcctgggccagggg
gtcgccaagaccgtcagcgaggggctcatcgccacgcccgtggggcagaaggggatgggc
atcctgttcgcggcgctggtcggcgcgatcatctggaacctcatcacctggtactacggc
ctcccctcctcgtcctcgcacgccctgttcggcggcatggtcggggcggcgctggccggc
gggacggacgtcatctggtccggcgtggtcgagaagatcgtcatcccgatgttcctctcc
ccggtcatcgggctggtcgtcggctatctggtgatggtcggcatcatgtggatgttccgg
aaggccaacccgcacaaggccaagcgcggcttccggatcgcgcagacggtctcggcggcg
ggcatggcactcggccacggcctccaggacgcgcagaagacgatgggcatcgtcgtgatg
gccctggtcatcgccgacgtcgagggccccaacgacgagatcccggtctgggtcaagatc
gcctgtgccgtgatgctctcgctgggtacgtacgcgggcggctggcgcatcatgcgcacc
ctcggccgcaagatcatcgagctggacccgccgcagggcttcgcggccgagacgaccggc
gcgtcgatcatgttcggctcggcgttcctgttccacgccccgatctccaccacgcacgtc
atcacctccgcgatcatgggcgtcggcgccaccaagcgggtgaacgccgtgcgctggggc
gtcgccaagaacatcatcctgggctggttcatcaccatgcccgccgcggccctggtcgcc
gcgctgagctacggggcggttctgctgctcttcggctga

DBGET integrated database retrieval system