KEGG   Streptomyces violaceoruber: B1H20_27875Help
Entry
B1H20_27875       CDS       T05124                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00040  Pentose and glucuronate interconversions
svu00053  Ascorbate and aldarate metabolism
svu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B1H20_27875
   00053 Ascorbate and aldarate metabolism
    B1H20_27875
Enzymes [BR:svu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     B1H20_27875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh IF-2B
Motif
Other DBs
NCBI-ProteinID: ARF64789
UniProt: A0A1V0UHS0
Position
complement(6374086..6375729)
Genome map
AA seq 547 aa AA seqDB search
MHPTEDASRSAADDSPAHGPTSSPGGQLPTGRSLLAGREVTGDGDAWYAVAAATGEPFGT
PYRDASAAQVAEAARLAAADARAYRALPAERRAAFLDACAEEIEALGDSLLESAARESGL
PLARLTGERGRTCGQLRLFADLVRSGSASGARLSSGPSGADVRLRRIPLGPVAVFGASNF
PLAFSVAGGDTASALAAGCPVVAKAHPAHPGTCEAVARAVTAAAARTGMPAGVFSLLVGR
GHEVGLALVGDPRIAAVGFTGSRAGGRALVAAAQARPVPVPVHAEMSAVNPVIMLDGALS
APEGTAAAYVASLTNGAGQFCTNPGLLLLPAGEAGNAFLAEAARLTEAAEGQVMLTPAVA
RSYTEGVRRWARTPGVREAARGTAGPGPCAPAPALLECDAAVYTAHEVLTGEVFGPAGLV
VRWRDTAELTGLLDQLEGQLTATLHAADSDRATALELLPVLEERAGRVLWGGWPTGVEVC
HAMVHGGPWPATSSPGTTSVGALAIDRWLRPVCYQSFPEALLPPELRTDAAPGTPRPTGP
GFTPELR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgcacccgaccgaagacgcatcgcgatccgccgccgacgactcccccgcccacggcccg
acttcctctccgggcggccaactccccaccgggcgctcgctcctggcgggacgcgaggtc
accggcgacggggacgcctggtacgcggtcgccgccgccaccggtgagccgttcggcacg
ccgtaccgcgacgcctcggcggcccaggtggccgaggcggcccggctggcggcggcggac
gcccgcgcctaccgcgcgctgccggccgagcgccgggcggccttcctcgacgcctgcgcg
gaggagatcgaggcgctgggcgattccctcctggagtcggcggcccgggagtccgggctg
cccctggcccggctgaccggcgaacggggccgcacctgcggtcagttgcgcctcttcgcc
gatctcgtcaggagcggatcggcgtccggcgcccggctctcgtccggcccctcgggcgcc
gacgtacggctccggcgcatccccctcggcccggtggcggtgttcggggcgagcaacttc
ccgctggcgttctcggtcgcgggcggtgacacggcgtccgcactggccgccggctgcccc
gtggtggccaaggcgcaccccgcgcacccgggcacctgcgaggcggtggcccgcgcggtc
acggcggccgccgcgcggaccgggatgccggccggcgtgttctccctgctggtggggcgg
ggccatgaggtgggcctcgccctggtcggcgacccgcgcatcgccgccgtgggcttcacg
ggctcccgggcgggcgggcgggccctggtcgccgccgcgcaggcccgccccgtacccgtc
ccggtccacgcggagatgtccgcggtcaacccggtgatcatgctcgacggggccctgtcc
gcaccggaggggaccgccgccgcgtacgtggcgtcgctgaccaacggcgcgggccagttc
tgcacgaacccgggtctcctgctgctgccggcgggagaggcggggaacgcgttcctggcc
gaggcggcccggttgaccgaagcggcggagggccaggtcatgctcaccccggccgtggcg
cgctcgtacaccgaaggcgtacgccggtgggcacggacccccggcgtacgcgaggcggcc
cggggcacggcgggccccggcccctgcgccccggcgcccgccctcctggagtgcgacgcg
gccgtgtacaccgcgcacgaggtgctcaccggcgaggtcttcggcccggcgggcctggtc
gtacgctggcgggacacggcggaactcaccgggctgctggatcagttggagggccagctc
acggccaccctgcacgcggcggactccgaccgggcgacggcgctggagctgctgccggtg
ctggaggagcgggcggggcgcgtcctgtggggcggctggcccaccggcgtcgaggtgtgc
cacgcgatggtgcacggcggcccgtggcccgcgaccagctcccccggaacgacgagcgtg
ggcgctctcgcgatcgaccgctggctgcgtccggtctgctaccagtccttccccgaggcc
ctgctgccccccgaactccgcaccgacgccgcgccggggaccccccgcccgaccggaccg
ggtttcaccccggaactccggtag

DBGET integrated database retrieval system