KEGG   Staphylococcus warneri: A284_07095Help
Entry
A284_07095        CDS       T02449                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
swa  Staphylococcus warneri
Pathway
swa00480  Glutathione metabolism
swa00590  Arachidonic acid metabolism
swa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A284_07095
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A284_07095
Enzymes [BR:swa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A284_07095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGC90736
Position
1518302..1518778
Genome map
AA seq 158 aa AA seqDB search
MENIYDFVVEKNTGETYKLEDYKDYVMLIVNTASECGFTPQFEGLQKLYEKYKDQKFIIL
GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPIHQKIDVKGEHQHPLFRFLTDAQQGMFNE
KIKWNFTKFLIDRDGNVVKRFSPQKKPAQLENEIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatatatgacttcgttgttgaaaagaatacaggagaaacatataagttagaa
gattataaagattatgtgatgttaatcgtaaatactgcaagtgaatgtggtttcacacca
caatttgaagggttacaaaagctttatgaaaaatataaagatcaaaaatttattatttta
ggctttccttgtaatcaatttggtggtcaagaacctggatcgggtgaagaagctgctcaa
aactgtaaattaaattacggtgtaacattccctatccatcaaaaaattgatgttaaagga
gaacatcaacatccgttattccgcttccttactgatgcacaacaaggaatgtttaatgaa
aaaattaagtggaacttcactaagtttttaatagatcgtgacggtaatgtagttaaacgt
ttttctccgcagaagaaacctgcacaattagaaaatgaaatcgaaaaacttctataa

DBGET integrated database retrieval system