KEGG   Staphylococcus warneri: A284_10875Help
Entry
A284_10875        CDS       T02449                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
swa  Staphylococcus warneri
Pathway
swa00900  Terpenoid backbone biosynthesis
swa01100  Metabolic pathways
swa01110  Biosynthesis of secondary metabolites
swa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A284_10875 (ipk)
Enzymes [BR:swa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A284_10875 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AGC91488
UniProt: L7WZI3
Position
complement(2292244..2293092)
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINFTLDTLFKRDDGYHEIEMIMTTVDLNDRLSFQKRDDRKIVVEIEHNFVT
DDHKNLAYKAAELMTKTYDLKQGVTITIDKDIPVSAGLAGGSADAAATMRGMNRLFNLNL
SLDELCALGSQIGTDVSFCIYNKTAYCTGRGEKVKFLNKPPSAWVVLAKPNLGISSPDVF
KALDLNFTHKVFTQNCIEALKKSDYKKLCTSLSNRLEPISMEMHPEIKKIKENMIQCGAD
GALMSGSGPTVYGLAQKESQAKNIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggcacctgccaaaataaattttacgctcgatacactttttaaaaga
gacgatggatatcacgagattgaaatgataatgactaccgtagatttaaacgatcgatta
tcttttcaaaaaagagatgataggaagatcgttgttgaaatcgaacacaactttgtaact
gacgatcataaaaatttagcatataaagctgctgaattaatgacgaagacatatgatttg
aaacaaggtgtaacgattacaattgataaagatattccagtatcggctggtttagcaggt
ggctcagcagatgcggcagctacgatgagaggtatgaatcgcttatttaatttaaattta
tctttagatgaattatgtgcacttggtagtcaaattgggacagatgtttcattttgtata
tacaataagactgcctattgtacaggacgtggtgaaaaagtgaagtttttgaacaaacct
ccttctgcttgggttgttttagctaagcctaatttaggtatctcatcaccggacgtattt
aaagccttggatttaaatttcacgcataaagtatttactcaaaactgtatagaagcttta
aaaaaatcagattataagaagttatgtacaagtttatctaatagattagaaccgatttct
atggagatgcatccagaaatcaaaaaaatcaaggaaaacatgatccaatgtggcgcagat
ggtgcattgatgagtggtagtggcccaacagtttatggattagcacaaaaagaaagtcag
gctaaaaatatttataacgcagtgaatggttgttgtaatgaagtatatttagttagatta
ttaggatag

DBGET integrated database retrieval system