KEGG   Staphylococcus warneri: A284_11470Help
Entry
A284_11470        CDS       T02449                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
swa  Staphylococcus warneri
Pathway
swa00071  Fatty acid degradation
swa00072  Synthesis and degradation of ketone bodies
swa00280  Valine, leucine and isoleucine degradation
swa00310  Lysine degradation
swa00362  Benzoate degradation
swa00380  Tryptophan metabolism
swa00620  Pyruvate metabolism
swa00630  Glyoxylate and dicarboxylate metabolism
swa00640  Propanoate metabolism
swa00650  Butanoate metabolism
swa00900  Terpenoid backbone biosynthesis
swa01100  Metabolic pathways
swa01110  Biosynthesis of secondary metabolites
swa01120  Microbial metabolism in diverse environments
swa01130  Biosynthesis of antibiotics
swa01200  Carbon metabolism
swa01212  Fatty acid metabolism
swa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:swa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A284_11470
   00630 Glyoxylate and dicarboxylate metabolism
    A284_11470
   00640 Propanoate metabolism
    A284_11470
   00650 Butanoate metabolism
    A284_11470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A284_11470
   00072 Synthesis and degradation of ketone bodies
    A284_11470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A284_11470
   00310 Lysine degradation
    A284_11470
   00380 Tryptophan metabolism
    A284_11470
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A284_11470
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A284_11470
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A284_11470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:swa04147]
    A284_11470
Enzymes [BR:swa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A284_11470
Exosome [BR:swa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A284_11470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGC91607
Position
complement(2425942..2427126)
Genome map
AA seq 394 aa AA seqDB search
MSRIVLAEAYRTPIGVFGGAFKDIPAYDLGATLIKHILKTTQIDPKEINEVILGNVLQAG
QGQNPARIASIKGGLPESVPAFTVNKVCGSGLKSIQLAYQSILAGDNDVVLAGGMESMSQ
SPMLMKNARFGFKMGNQALVDSMVADGLTDVFNDYHMGITAENLVEKYSISREAQDEFAA
QSQQKAEAAQNSGAFDAEIVPVEVPQRKGEPIVVSEDEGIRKGTTADKLSHLRPAFKKDG
SVTAGNASGINDGASMMLVMTEEKAKELNIKPIAILDGFGTSGVDPSIMGIGPVDAVKKA
LQRTNQSIEDIDVFELNEAFASQALAVNQELQLPAEKVNTKGGAIALGHPIGASGARILV
TLLHQLNEEKQSGIASLCIGGGQGIATAVTRYQE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtatcgtattagctgaagcatatcgtacaccaattggcgtgtttggaggcgct
tttaaagatattcctgcctatgatttaggtgctactttaattaaacacattttaaaaaca
actcaaattgatccaaaagaaattaatgaagtgatattaggtaacgttttacaagcaggt
caaggacaaaacccagctcgcatagcatcaattaagggtggtttacctgaatctgttcca
gcatttacagtaaataaagtctgtggttcaggattaaaatctattcaattagcgtatcaa
tctattttagcaggtgacaatgacgtcgtattagcaggtggcatggaaagtatgtcacaa
tcaccgatgcttatgaaaaatgcacgcttcgggtttaaaatgggtaaccaagcgttagtt
gatagtatggtagcagatggattaacagatgtatttaatgattatcatatggggattacg
gctgaaaacttagttgaaaaatatagtattagccgtgaagcacaagatgaatttgctgca
caatcacaacaaaaagcagaagccgctcaaaatagtggtgcttttgatgcggaaatcgtt
ccagtcgaggtaccacaacgcaaaggagaacctattgtcgtatcagaagacgaaggtatt
agaaaaggtacaacagctgataaattgagtcacttgagacctgcctttaaaaaggacgga
tcagtaacagctggtaatgcgtcaggtattaatgacggtgcatcaatgatgttagtaatg
actgaagaaaaggcaaaagaattaaatattaaacctatcgctattttagacggctttggt
actagtggtgtggatccttctattatggggattggtccggttgacgcagtgaaaaaagca
ctacaacgtacaaaccaatctattgaagatatcgatgtcttcgaacttaatgaagcattt
gcatcacaggctttagcagtaaatcaagaattacaattacctgctgaaaaggttaatact
aaaggtggtgccattgctttaggtcatcctataggtgcctcaggtgcacgtatattagtg
acacttttacatcaattaaacgaagaaaagcaatcaggtattgcctcattatgcattggt
ggcggacaaggtattgcgacagcggtgacacgttatcaagagtaa

DBGET integrated database retrieval system