KEGG   Staphylococcus warneri: A284_11700Help
Entry
A284_11700        CDS       T02449                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
swa  Staphylococcus warneri
Pathway
swa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:swa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A284_11700
Enzymes [BR:swa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A284_11700
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A284_11700
    1.1.1.-  
     A284_11700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C Pyr_redox AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGC91651
Position
complement(2470932..2471969)
Genome map
AA seq 345 aa AA seqDB search
MKAAVWYGQKDVRVEEREPKELQDNEVKVKVSWAGICGTDLHEYLEGPIFISTEKPDLFL
GQKAPVTLGHEFAGVVEETGSKVTKFNKGDRVVVNPTVSKREKEENIDLYDGYSFIGLGS
DGGFAEFTNAPEENVYKLPDNVSDKEGALVEPTAVAVQAIKEGEVLFGDTVAIFGAGPIG
LLTVVAAKAAGASKIFVFDLSEERLSKAKALGATHAINSGKTDPVDVINKYTENGVDVSF
EVAGVAPTLKSSIDVTKARGTVVIVSIFGHPIEWNPMQLTNTGVKLTSTIAYTPTTFQQT
IDLINEGNLNVKDVVTDEIELENIVESGFEQLVNDKSQAKILVKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggtatggtcaaaaagacgtaagagttgaagaacgtgaacctaaa
gaattacaggacaatgaagttaaggttaaagtatcttgggctggcatttgtggtacagat
ttacatgaatacttagaaggtcctatatttatttcaacagaaaagccagatctattctta
ggccaaaaagctccagttacattgggtcatgaatttgcaggtgtggtagaagaaactggt
tccaaagttacaaaatttaataaaggcgatcgagttgtagttaaccctacagtttcaaaa
cgtgaaaaagaagaaaatattgacctttatgatggttattcatttataggcttaggttct
gatggtggatttgcagagtttacaaatgcgccggaagaaaatgtttataaactaccagat
aatgtttctgataaagaaggtgcgcttgtcgaaccaacagccgttgcagttcaagcaatt
aaagaaggtgaagttctatttggtgatactgtagctatttttggtgcaggaccaattgga
ttattaacagtcgtagcagccaaagcagctggtgcaagtaaaatatttgttttcgattta
tcagaagaaagactaagtaaagctaaagcactaggcgcaactcatgctataaactctggt
aagacagatccagttgatgttattaataagtatacagaaaatggtgtagatgtatctttt
gaagtggctggtgtagcaccaacacttaaatcttctatagatgttacaaaagcaagaggt
acagttgttatcgtttctatttttggtcatcctatcgagtggaatccaatgcaattaact
aatacaggagtaaaacttacttctacaattgcatacacacctactacattccaacaaaca
attgacttaatcaacgaaggtaatttaaacgttaaagatgtagttactgatgaaattgag
ttagaaaatatcgtagaatcaggatttgaacaacttgtaaatgataaatctcaagcaaaa
attttagttaaattataa

DBGET integrated database retrieval system