KEGG   Shewanella woodyi: Swoo_0180
Entry
Swoo_0180         CDS       T00676                                 

Definition
(GenBank) LexA repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:swd01002]
    Swoo_0180
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:swd03400]
    Swoo_0180
Enzymes [BR:swd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     Swoo_0180
Peptidases and inhibitors [BR:swd01002]
 Serine peptidases
  Family S24: LexA family
   Swoo_0180
DNA repair and recombination proteins [BR:swd03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Swoo_0180
SSDB
Motif
Pfam: Peptidase_S24 LexA_DNA_bind HTH_27 HTH_Crp_2 Sigma70_r4 Rrf2 HTH_20 MarR MarR_2 Peripla_BP_6
Other DBs
NCBI-ProteinID: ACA84481
UniProt: B1KM68
Position
complement(217677..218294)
AA seq 205 aa
MRPLTPRQAEILELIKCNIAETGMPPTRAEIAKRLGFKSANAAEEHLKALAKKGCIEIIP
GTSRGIRLAQTEELEEQGLPLIGQVAAGEPILAQEHVEQHYQVDPNMFHPSADFLLRVRG
DSMKDIGILEGDLLAVHKAEQARNGQVVVARVEDDVTVKRFEKKGSTVYLHAENEDYSPI
VVDLTNQSLSIEGLAVGVIRNGDWQ
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagacctttaacaccacgacaagctgaaattcttgaactaattaaatgcaatattgcc
gaaacaggcatgcctccaacccgtgcagaaattgctaaacgtttaggttttaaaagcgcc
aacgctgctgaggaacacctaaaggctctagctaaaaagggctgtattgagatcattcct
ggtacatctcgtggtattaggttagctcaaacagaggagcttgaagagcaaggcttacct
ttgataggccaagttgcagctggggagcctatcctagctcaagagcatgttgaacagcat
tatcaagttgatccaaatatgttccatccaagtgccgactttctacttagggtacgtggc
gacagcatgaaagatatcggtattctcgaaggagatcttctggctgtccataaggctgag
caagcaagaaacggtcaggttgtcgttgcccgtgttgaagatgatgtaacagttaaacgc
ttcgagaaaaaaggcagtactgtttaccttcatgcagaaaatgaagattacagtcctata
gtcgttgatctaactaaccaaagcctaagtattgaaggattggctgtcggtgttattcgc
aatggagattggcaatga

DBGET integrated database retrieval system