KEGG   Shewanella woodyi: Swoo_1408
Entry
Swoo_1408         CDS       T00676                                 

Definition
(GenBank) 3-hydroxyanthranilate 3,4-dioxygenase
  KO
K00452  3-hydroxyanthranilate 3,4-dioxygenase [EC:1.13.11.6]
Organism
swd  Shewanella woodyi
Pathway
swd00380  Tryptophan metabolism
swd01100  Metabolic pathways
swd01240  Biosynthesis of cofactors
Module
swd_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
swd_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Swoo_1408
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.6  3-hydroxyanthranilate 3,4-dioxygenase
     Swoo_1408
SSDB
Motif
Pfam: 3-HAO Cupin_2 AraC_binding Cupin_4 Cupin_3 Jiv90
Other DBs
NCBI-ProteinID: ACA85700
UniProt: B1KJM7
Position
complement(1768306..1768875)
AA seq 189 aa
MSKLAAFNFQQWIDEHQHLLKPPVGNVQIWENTDMMVTVVGGPNQRTDFHDDPVEEFFYQ
LKGDMVLKIIEEGKCHDLFIREGDIFFLPPHVRHSPQRPMPGSIGLVIEPKRPEGAKDAF
EWYCFKCDGLVHRVEVLLKSIVRDLPPIYQAFYQDEQARTCPQCGELHPGKEPPQGWVTL
LENKEQDKS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagtaaattagccgcgtttaactttcagcagtggatagatgagcaccagcacctactc
aagccacctgtgggtaacgtacagatctgggaaaataccgacatgatggtcactgtggtc
ggtggtccaaatcagcgtaccgattttcatgacgatcctgtcgaggagttcttttatcaa
ctcaaaggcgacatggtgctcaagatcatcgaagagggcaagtgccacgatctgtttatc
cgtgagggtgatatctttttccttcctccccatgtacgtcactccccccagcgccctatg
cctggcagtattggtttagtgatagaacctaagcggccagagggagctaaagatgctttc
gagtggtactgctttaaatgtgatggcttagttcacagagttgaggtgttacttaaatcg
attgttcgagatctcccccccatctatcaagctttctatcaagatgagcaagcccgaacc
tgcccccagtgcggtgagctgcacccaggaaaagagcccccacaaggctgggtgacccta
ctagaaaataaagagcaggataagtcatga

DBGET integrated database retrieval system