KEGG   Shewanella woodyi: Swoo_1715Help
Entry
Swoo_1715         CDS       T00676                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
swd  Shewanella woodyi
Pathway
swd00360  Phenylalanine metabolism
swd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
swd00790  Folate biosynthesis
swd01100  Metabolic pathways
swd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Swoo_1715
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swoo_1715
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Swoo_1715
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Swoo_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ACA86000
UniProt: B1KMK2
Position
2131344..2132141
Genome map
AA seq 265 aa AA seqDB search
MSKQTEYVARLPDAKGQLHFPQDEHDIWQALYQRQLDNLPKFACAEYQQGLKKLALCDDK
IPQLTEIDKVLLDSTGWKTAAVPALISFEKFFALLANKEFPVATFIRSKDEFDYLREPDI
FHEVFGHCPLLTNPSFAHFSHVYGKLGLAASKEDRVFLARLYWFTVEFGLIQKRDNSLEI
YGGGILSSPGETLYAMGSTPEIRPFNLLDVLRTPYRIDIMQPVYYAIDSIEYLDEIVKMD
IMGAVAEAKKLGLFEPLFEPKSKAS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaaactgagtatgtagcccgtttgcctgatgcaaagggtcagctacatttt
ccacaagatgaacatgatatttggcaagccctctatcaaaggcaactcgataacttacct
aagtttgcttgtgctgagtatcaacaaggcttgaagaagctagccctttgtgatgataag
atccctcagcttaccgagatcgataaagtcttgttagatagcacgggctggaaaactgca
gcagtgcctgcacttatttcatttgagaagttttttgctcttttggctaacaaagagttt
cctgttgcaacctttattcgttccaaagatgagtttgattatctgcgtgaaccggatatt
tttcatgaagtatttggccactgtccgctattaactaacccctcatttgcacatttttca
catgtttatggaaaattaggcttagctgcaagtaaggaagatcgtgtcttcttggcaagg
ttatattggtttactgttgagtttggccttatccagaagagagataactctttggagatc
tatggaggaggcattttaagctcgccaggtgaaacactttatgccatgggaagtacacct
gagataagaccattcaatctactcgatgtattgagaacaccatatcgtatcgatattatg
cagcctgtgtattatgcaattgatagcattgagtatcttgatgagatcgtaaagatggat
attatgggagctgtagctgaggcgaagaagctaggtctatttgagcctctgtttgaaccg
aaatctaaagccagttaa

DBGET integrated database retrieval system