KEGG   Shewanella woodyi: Swoo_1838Help
Entry
Swoo_1838         CDS       T00676                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
swd  Shewanella woodyi
Pathway
swd00020  Citrate cycle (TCA cycle)
swd00310  Lysine degradation
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01200  Carbon metabolism
Module
swd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Swoo_1838
  Amino acid metabolism
   00310 Lysine degradation
    Swoo_1838
Enzymes [BR:swd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Swoo_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACA86122
UniProt: B1KPG9
Position
2273960..2275150
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVQPGEQVTRDQNLVDIETDKVVLEVVAPEDGSIAEFL
ANEGDTVLGEAVIAKFTAGAVAGQEVTKAEAEATTPEAADDTNDALSPSVRRLLGEHGLE
ASQVKGTGAGGRITKEDVEAFVKSKSAAPAPTASAQVDVAPLAERSEKRVPMSRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQEVFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMSLADIERNVRELAIKGRDG
KLTVDDMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIIDGRESVGYLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgtactaccagaatctgttgctgatgcaactattgct
acttggcatgttcagcctggtgaacaagtaacacgtgatcaaaaccttgttgatattgaa
actgacaaggttgtacttgaagtggttgcccctgaagatggatcgattgctgaatttcta
gcaaacgaaggcgacactgttcttggtgaagctgtcatcgctaagttcactgctggcgct
gttgctggtcaagaagtgacgaaagcggaagctgaggccaccacacctgaagctgctgat
gacaccaatgatgctctaagcccatctgttcgccgtttactgggtgaacatggtcttgaa
gcaagtcaagttaaaggcactggtgctggcggtcgaattacaaaagaagatgttgaagcg
tttgtgaagagcaagtcagcagctcctgcaccgacggctagtgcacaggtagatgttgca
ccattagctgagcgtagcgagaagcgtgtacctatgtcacgtcttcgtaagacaattgca
aaccgtctacttgaagctaaaaactctacagctatgttgacgacatttaatgaagttaac
atgaagccaatcatggatatccgtaagcagtatcaagaggtttttgagaagcgtcatggg
atccgtttaggttttatgtctttctacattaaagcggtaacggaagcgttgaagcgtttc
cctgaagtgaacgcttctatagatggtgatgatattgtttatcacaactactttgatatc
agcattgcggtgtcaacgccacgtggtcttgtgacacctgttcttcgtgatacagacacc
atgagccttgcagatatcgagcgtaatgttcgtgaacttgcaattaaaggtcgtgacggt
aagttgactgttgatgatatgactggcggtaacttcactgtgactaatggcggtgtattt
ggttcactcatgtccaccccaattcttaatctgccacaaagtgcaatccttggtatgcat
gccatcaaggatcgcccaatggcagtgaatgggcaggttgaaatcctacctatgatgtac
ctagcattatcttacgatcaccgtattatcgatggtcgtgagtcagttggttacttggtt
gccattaaggacttcctcgaagacccaactcgtctgctgcttgatctataa

DBGET integrated database retrieval system