KEGG   Shewanella woodyi: Swoo_2345Help
Entry
Swoo_2345         CDS       T00676                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
swd  Shewanella woodyi
Pathway
swd00260  Glycine, serine and threonine metabolism
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swoo_2345
Enzymes [BR:swd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Swoo_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACA86624
UniProt: B1KF83
Position
2879855..2880868
Genome map
AA seq 337 aa AA seqDB search
MAGVIDLRSDTVTQPCQVMRTLMVEAQTGDDVYGEDPSVKQLESFAAELLNKQAAVFCPS
GTQSNLMGLLSHCGRGDEFIVGSAAHTYLYEGGGAAVLGSIQPQPLNLQSDATMDLSELE
SAIKPKDVHYARTKLICLENTHGGVPLPDGYTQAVNAIAQRHKLGMHLDGARLFNAVVAG
NTSAAALTADFDSVSICLSKGLGAPVGSLLVGSNEFIDEARHWRKMLGGGMRQAGIIAAA
GLYALQNNINRLSDDHRRASELASALGQIDGVSIPLGQAHTNMLYVSVSQAMRQRLAEHE
ANYNILLPSGEQMRLVTHLNINDDDLKAIIELFQQAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagtgatcgatttacgcagcgatacagtcacccagccctgtcaagtcatgcgt
accttaatggtcgaagctcaaacgggtgatgatgtttatggtgaagaccctagcgttaaa
cagcttgaatcttttgcagctgagttactcaataaacaagccgcggtattttgtccctca
gggacccaaagtaatttgatggggctactgtctcattgtggccgaggtgatgagttcatt
gttggcagcgccgcacacacctatctatatgaaggcggcggtgcagcggtattagggagt
atccagccccaaccattaaacctgcaaagtgatgcaacgatggacctatcggagctggaa
agtgccattaagcctaaggacgttcactatgccaggaccaagttgatatgcttggaaaat
actcatggtggcgtcccgttgcctgacggttacactcaagccgttaacgcaatagcccag
cgccataagctggggatgcatttagatggtgctagattatttaatgccgttgttgcaggt
aatacaagtgctgcagcattaaccgctgattttgacagtgtttcaatctgtttatcaaaa
ggcttaggcgcccctgttggctcgttactggttggctcaaatgagttcatcgatgaagcg
aggcattggcgcaagatgttaggtggcggtatgcgtcaagctggcattatcgctgcggca
ggtttatatgccttacaaaacaatataaatcgcttaagtgatgatcaccgccgagcaagc
gaattagcaagtgcgctggggcaaatcgatggggttagtatcccgctaggtcaggcccac
accaacatgttgtatgtgagcgttagccaagcgatgagacaacgccttgctgagcatgaa
gccaattacaatatattgctgccttctggggagcagatgcgtttggtcactcacttaaat
attaatgatgatgacctaaaagccattattgaattatttcaacaagcggcttaa

DBGET integrated database retrieval system