KEGG   Shewanella woodyi: Swoo_2512
Entry
Swoo_2512         CDS       T00676                                 

Definition
(GenBank) PAAR repeat-containing protein
Organism
swd  Shewanella woodyi
SSDB
Motif
Pfam: PAAR_motif DUF2974 Lipase_3 PGAP1
Other DBs
NCBI-ProteinID: ACA86789
UniProt: B1KGS0
Position
complement(3066803..3068188)
AA seq 461 aa
MPKAARLGDSCAGHGCMPATPIIAGSGDVSINGKPAARKGDTVLLHACPCPNMPHGIHGR
SISAGSSNVSINGKPAARVGDAVGCGGSVAAGSGDVLIGDTPYKSPTHKCGENAVKDNTP
LLAMAPMPILAAIKWGEPANQFITADSVVTTVKQRKARYQARKKLASSTANESDPKIKAA
SERLDFNNDSILRAEAAQYVYRVDENRRDPAKYPLPEAPVGLEVLDTKTIPGLENAVVMS
KKSGFGAAIFKSEINDATMLTYRGTNNGVTGKKDWKTNGAQGIGKQTKQYDQAMHLARQV
KRSLGKEVEIVGHSLGGGLAASAVGVTGIKGYSFNSAGLHENTVSRQGGLKMEKIKGLIQ
SQSVDGEVLTLLQSNRGVVAPLLAGVGSALGGTVGTAIGGILGAAILNSGAAPEAPGNMR
ELKSIEGGNPVTRHGMDQVIAGIEAQKKQDITTLTQYHWGQ
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgccaaaagcagctcgattaggggatagttgtgcaggccatggttgtatgcctgcaacg
cctattatcgcaggcagtggtgatgttagcattaacggcaagcccgctgcgcgtaaaggt
gacacggtattgctgcatgcttgcccctgtccaaatatgccccacggtatccatggtcgc
agtatctctgcggggtcatctaatgtttctatcaatggtaaacctgctgctcgtgttggt
gatgctgtgggttgtggcggctcagttgcagcaggcagtggcgatgtacttataggtgat
accccctataaatcgccgacgcataaatgtggtgaaaatgcagttaaagataacacgccg
ctgttagcgatggcgcccatgccgattttagcggccatcaaatggggagagcctgctaat
cagttcatcaccgcggattctgtcgttacaacggtgaagcagagaaaagcgcgctatcag
gcacgtaaaaagttggcaagctccacagcaaatgaaagtgaccctaaaattaaagcggcc
agtgaaaggttagattttaataatgacagtattttacgtgctgaagcggcgcagtatgtc
tatagagtcgatgagaaccgacgggatcctgcaaaatacccactacctgaagcacctgtt
gggcttgaagtacttgatactaaaacaattcccgggttagaaaatgcagtggtaatgagt
aaaaaatctggatttggtgctgccatatttaaatcagaaataaatgatgccaccatgctg
acctaccgaggtaccaataatggtgttactgggaaaaaagactggaaaactaatggtgct
caaggtattggtaaacagacaaagcagtatgatcaggcgatgcatttagcgcggcaagtt
aaacgctctctaggtaaagaggttgaaattgtaggccactctttaggtggaggcttagca
gcgagtgcggtcggtgtgacaggaattaagggttatagctttaactcggccggtttacac
gagaatactgttagccgtcagggagggttaaagatggaaaaaattaaggggttgatacaa
agccagtccgttgatggtgaagtgctgactctactacagagtaatagaggtgtggttgcc
ccattattagcgggtgttggcagtgctttaggtggcacagtgggcacggcaatcggtggg
atattaggggctgcgattctcaatagcggcgccgcgccagaagctccgggtaatatgcga
gaacttaaaagtatcgaaggtggtaacccagttacccgtcatggtatggatcaagtgatt
gcggggatcgaggcgcagaaaaaacaagatattactacattgacgcaataccactgggga
caataa

DBGET integrated database retrieval system