KEGG   Shewanella woodyi: Swoo_2513Help
Entry
Swoo_2513         CDS       T00676                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
swd  Shewanella woodyi
Pathway
swd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:swd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Swoo_2513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swd02044]
    Swoo_2513
Secretion system [BR:swd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Swoo_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345
Motif
Other DBs
NCBI-ProteinID: ACA86790
UniProt: B1KGS1
Position
complement(3068198..3070246)
Genome map
AA seq 682 aa AA seqDB search
MALLGSGLRFHFKAQSLADDSFDVLDFNFIESLSSPFEVKLTLLSRLDNLTPEAIVDQTG
LMSWSQGESVERHVHGIVSQFSKGDSGHHHTQYNVTIVPALSRLKLRKNSRIFQQQNVLV
IISTLLNEMGISDYAFSCDARFESEVREYCVQYSETDFEFISRLAAEVGLFYYFEHTQDV
HTLIFCDSTSKLSGLKSPFPYNVLSGGVAENTFVNQFSYQHQIKPANISLKDYSFKKPQY
SFLQSSKGQELKFQKPDYEHFDYPGRYKDDAAGVPITQVRQEYLRRDAQVATGQSNILQA
IPGFKFDLIEHNDRALNRDWILTSIEHTGEQGAAAEEANTQKPTRYSNQFHAIPGNNPWQ
AEPNSKPLVTGPQIAIVVGPKNEEIFCDEFGRVKVQFPWDRYGESNEHSSCWVRVSQGWA
GGQYGMMAVPRIGHEVIVSFLEGDPDQPIITGRAYHTTNVTPYILPNHKTRTVIKTQSHK
AEGFNELRFEDEASREQIYVHGQKDMDMVINNIHREEIGYDQHLTVEHDKFELVKQHRHT
TIGQDEIAQVGRDHQVLVGRNLIHRVVGMVKRYIGGGIITQIDGASQTSIAASEEKIIGA
NQQIKVDNESYLKASKIVLEAGDELTIKGPGGFIKIDSGGVTISGSKVKINEGGSPGTGT
APKAVKPEEPAKPSIPETADRR
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttttaggctccggattgcggtttcattttaaagcgcaaagcttagctgatgat
agctttgacgtgcttgatttcaattttattgaaagcttatcgagtccttttgaagttaag
ctcactctgctgagtcggctcgataatctgacccctgaggcgattgttgatcaaaccggt
ttaatgagctggtcgcaaggggagagtgttgagcgacatgttcatggcatcgtcagtcag
ttcagtaaaggtgacagtggtcatcatcatactcaatacaatgtcactatcgttcccgct
ttatcacgcctgaaattaagaaagaatagtcgaatattccagcagcaaaatgtacttgtc
atcatctcaaccctgctaaatgagatggggataagtgattacgcctttagctgtgatgca
cgatttgaatctgaagtacgtgagtattgtgttcaatacagtgaaacggatttcgagttt
atcagccgtttagctgcggaagtggggctgttttactattttgagcatactcaagatgtt
cacacacttatcttctgtgacagcacaagtaaattgagtggcttaaaaagcccatttccc
tataacgtgctcagtggtggagttgccgaaaacacctttgttaatcaatttagttaccaa
caccaaattaagcccgctaatatcagcttaaaagattacagctttaagaagcctcaatat
agttttctgcaaagcagtaagggccaagagctcaagtttcaaaagcctgactatgagcat
tttgattaccctggtcgctataaagatgatgctgctggggttcctattacacaagttcgt
caagaatatctgcgccgtgatgctcaagttgccacagggcagagtaatattttgcaggct
atcccaggttttaagttcgatctcattgaacataatgaccgagcgcttaatcgtgactgg
atattaacgtcgattgaacacactggtgagcagggggcggcagctgaagaggcaaacaca
caaaagcccacacgttacagtaatcaatttcatgcaatcccaggtaataacccttggcag
gctgagccaaacagtaagcctttggttacaggtccacaaattgccattgtggttggcccc
aaaaatgaagagatattttgtgatgagtttggccgagtaaaagtccagttcccatgggac
agatatggagagagtaacgagcactccagctgctgggttcgagtcagtcaaggttgggct
ggggggcaatatggcatgatggctgtgccacgtattggtcatgaagtgattgttagcttc
ttagagggcgatcccgatcagccaattattacaggtagagcctatcacaccaccaatgta
accccctatatcttgcctaatcataaaacccgaaccgtgattaaaacccagagtcataaa
gccgaagggtttaatgaactgcgttttgaagatgaggccagtcgtgagcagatctatgtt
catggacagaaagatatggatatggtgattaacaatattcatagagaggagattggctac
gatcagcatctgactgttgaacatgacaaatttgaactggttaagcagcaccgccataca
acaataggacaagatgagatagctcaagttgggcgggatcatcaagtccttgttggacgt
aaccttattcaccgagtggtaggtatggttaagcgttatattggcgggggcatcattact
caaattgatggtgctagccagacgagtattgcagcctcggaagagaagataattggcgcc
aatcaacagatcaaagtcgataacgagagctatcttaaagcaagtaaaatcgtcctcgaa
gctggtgatgaactcactattaaaggtcccggtggctttattaagattgatagcggtggt
gtgactatctctggcagtaaagtgaagataaatgagggcggatcccctggaacagggaca
gcgcctaaagcggtgaaaccagaagagcccgctaaaccttcaatcccagaaactgctgat
aggcgttaa

DBGET integrated database retrieval system