KEGG   Shewanella woodyi: Swoo_2514
Entry
Swoo_2514         CDS       T00676                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
swd  Shewanella woodyi
Pathway
swd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:swd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Swoo_2514
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swd02044]
    Swoo_2514
Secretion system [BR:swd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Swoo_2514
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACA86791
UniProt: B1KGS2
Position
complement(3070518..3071036)
AA seq 172 aa
MPTPCYISIKGQTQGDITAGAFTADSVGDIFVEGHEDEMLVQEFDHIVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLMYNSLASGEKITEVELKWYRTSVEGKQEHYFSTKLEGATI
IDIQCQMPHCQDPNKSDFTQLVTVSMAYRKIDWDHTVAGTSGSDDWRKPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacaccatgttatatctcaatcaaaggacagactcagggcgatatcactgcgggc
gcgtttactgctgattctgtcggtgacatttttgtcgaaggccatgaagatgagatgctg
gttcaagagtttgatcatatcgtgactgtgccgacagaccctcaatctggacaaccatct
ggccagcgtgtgcacaaaccatttaagtttaccgttgcgctaaacaaagcagtgccattg
atgtacaactctttagcttcaggtgagaagatcactgaagttgaactcaagtggtaccgc
acttcagttgaaggtaagcaggagcattacttcagtactaagttagagggcgcgacgatc
atcgatattcaatgtcagatgccgcactgtcaagatcctaataaatctgattttactcag
ctggttactgtgtctatggcttaccgtaaaatcgactgggatcataccgttgctggtact
tctggttctgatgactggcgtaagccgatcgaagcataa

DBGET integrated database retrieval system