KEGG   Shewanella woodyi: Swoo_2517Help
Entry
Swoo_2517         CDS       T00676                                 

Definition
(GenBank) type VI secretion-associated protein, VC_A0119 family
  KO
K11910  type VI secretion system protein VasJ
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swd02044]
    Swoo_2517
Secretion system [BR:swd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Swoo_2517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N
Motif
Other DBs
NCBI-ProteinID: ACA86794
UniProt: B1KGS5
Position
complement(3076114..3077517)
Genome map
AA seq 467 aa AA seqDB search
MTHQYIEKIAKPIAGDNPVGERLFDDVLFDFVEGQLMKVGSLSHAEVQWGEVETAVVSLL
ETRTKDLKLIIYLMQCLQYQASLERFSLSLGVLDIFMKEYWLTCYPAPGDRGVLPRRKYF
SQIVQRTVKSGESIDTQFCEPQSKELLLKRLSSLLDSAEKLELPTEVLSSLATRLTRQLE
QNENRVSATKSNAVSEPAEEAVSRSAPKLEIDSSNDKATKQTLLKVADFISEFETGTGLS
LRIRRFATWSSVSGVPENANAAGETSLMPIAADRVSEYQSQLEKGADMALLRRVELSLTL
SPFWLDGHHLSAQIAMALGQLEWAKAIHEDTAAFVERLPKLLMMSFKGGIPFANAETRTW
LDEGYGRNSFEGNGQGVEQKRAEVVELADSGGLSVAFASLNEHLQQASEPRDAFYLRLLG
ADLKQSHQLSAMATVDYQVLYQQASHMVLADWEPTLMARLKQKANLD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacacatcaatatattgaaaagatagcgaaacccattgctggagataatcctgtcggt
gaaagactttttgacgatgttttgtttgattttgtcgaaggtcaattgatgaaggttgga
tctctttctcatgcagaggttcagtggggagaggtggaaaccgctgtggtctcattattg
gagactcgcactaaagatctaaagctcatcatctatttgatgcaatgccttcaataccaa
gccagccttgagcgatttagtttatcccttggtgttttagatatcttcatgaaggagtat
tggctgacttgctaccctgcaccaggggataggggcgtactacctaggcgcaaatatttc
tctcagattgttcagcgaacggtaaagtctggggaaagtatcgatacacaattttgtgag
ccacaaagtaaagagttgctgcttaagcgcttgtccagcttactcgactcggctgagaag
ttggagctgcctacggaggtgctctcctcattagcaacaagactaaccagacagttagag
caaaatgaaaacagagtatcggcaaccaagtcgaacgcggtcagtgaacctgctgaggag
gcggtaagcagaagtgcgcctaagttagagatagactcgagcaatgataaagcgaccaaa
caaaccttgcttaaagtggctgattttatctctgagtttgaaactgggacaggactaagc
ttgcggatccgtcgatttgctacttggtcatcagtgagcggtgtgccagaaaatgccaat
gctgctggtgaaaccagtttgatgccgattgcagccgatagggtcagtgagtatcaaagt
cagctagagaaaggggcggatatggcgctgcttaggcgcgttgagttgagcctgacgtta
agccctttttggttagatggacaccacttaagtgcccaaattgccatggcgcttgggcag
ctagagtgggctaaggcgatacatgaagacactgcggcctttgttgaacgtctgcctaag
ctactcatgatgtcatttaaaggcggcattccttttgccaatgccgagactcgaacttgg
ttagatgaaggttacggacgcaacagttttgaagggaacgggcagggagttgagcaaaaa
agggctgaggtggttgagctggcagattcgggtggcttatcggtcgcttttgccagtttg
aatgaacatctacagcaagcatcagagcctagagatgcattttatctacgtctgctgggt
gcagatctaaaacagagtcatcaattgtcagcgatggcaacggtggattatcaagtcttg
tatcaacaagcaagtcatatggtcttagctgattgggagccaaccttgatggctcgatta
aaacaaaaagcaaatttggattaa

DBGET integrated database retrieval system