KEGG   Shewanella woodyi: Swoo_2522Help
Entry
Swoo_2522         CDS       T00676                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swd02044]
    Swoo_2522
Secretion system [BR:swd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Swoo_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE GMP_synt_C
Motif
Other DBs
NCBI-ProteinID: ACA86799
UniProt: B1KGT0
Position
complement(3083105..3084439)
Genome map
AA seq 444 aa AA seqDB search
MSSRNRVIWAEGLFIKPQHFQQQQRYFEYVTDERMTSVNSYLYGISQLELNPEYLGFGRI
AIQRAKGVMPDGTVFNIPQEDVLPSALEVVDGSLANQIVYLALSLRSDSITEVTESTSSG
NTRFVTHRHEVRDIHSEQGDFSTIDVSPVQMKLMFEKEDRSAYSSVAIAKILEKRPDGSV
VLDPNFIPCHYNVLGVPFLHRFIGEMAGMMRERAKNIAVRIGSPSQGGVADVSDFMLLQA
LNRMQPVLQHLSQLKSLHPEQLYQTLVSICGELFSFTDDSRIAPIFKPYDHDMPITSFGQ
LMNMLRQSLSIVLEPKAVSLQLQKRKYGLMVAPVQDPDLIKEADFILAVRAKLPLEELKK
LFIQQTKIASVEKIRELISLQLPGVGLTPLPVAPRQLPYHAGYTYFQLDRTSPSWEMLQH
STGFAFHVAGEFPELELQFWAIRS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaagaaatagagtaatttgggctgaaggtttattcatcaagccacaacatttt
cagcagcagcaacgttattttgagtatgtcaccgatgagcgtatgacctcggtcaacagc
tacctctacggtatatcacagctcgagctaaaccctgagtacctcgggtttggtcgtatt
gcgattcaacgagctaaaggcgtgatgccagatggaacagtatttaatattccccaagag
gacgttctgcctagtgcactggaagttgttgatggctcattggccaaccagatagtgtat
ctggcactgtcactacgcagtgattcgataactgaagtgacggagagtacctcatcgggt
aatacccgctttgtgactcatcgccatgaggtgcgagacattcatagtgagcagggggat
ttttctaccatagatgtcagccctgtacagatgaagctgatgtttgaaaaagaggatcgc
agtgcctactcctcagtggcgatagctaaaatcttagaaaaacgtccagatggtagtgtg
gttctggatcctaactttattccttgtcattacaatgtgctgggtgtgccgtttctgcat
cgattcattggtgagatggcagggatgatgagagaaagagctaaaaatatagcggttaga
ataggctcgccaagtcaaggtggcgtcgctgatgtgtcagattttatgctgttacaagca
ttaaatcgcatgcaacctgtactgcaacacctctcacaactgaaaagcctgcatccagag
caactgtatcagacattggtgagcatttgtggagagctattctcctttaccgatgacagt
cgaattgcgccaatatttaaaccttacgatcatgatatgccgatcacctcctttggccaa
ttgatgaatatgctacgtcagtcattaagtatcgtccttgagcctaaagccgtgtcctta
cagttacagaaacgtaagtacggattgatggttgcgccagtacaagatcctgatttgatc
aaagaggctgatttcatcttagctgttcgcgctaagttgcctttagaggagctgaaaaag
ctctttattcaacaaactaagatcgcttccgttgagaagatccgcgagttgatctcgttg
caacttcctggtgtcggtttaactccgctacccgtggcgccaagacagttgccatatcac
gcaggttacacctatttccaacttgataggacaagcccatcttgggagatgttacaacac
tcaactggatttgccttccatgttgctggtgagtttcctgagctcgagttgcagttctgg
gcgataaggagctag

DBGET integrated database retrieval system