KEGG   Shewanella woodyi: Swoo_2527
Entry
Swoo_2527         CDS       T00676                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swd02044]
    Swoo_2527
Secretion system [BR:swd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Swoo_2527
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACA86804
UniProt: B1KGT5
Position
complement(3089055..3089480)
AA seq 141 aa
MFNHDDTFGVSFFQRLGDENEHASNGSESIEYVIASIKRNISGLLNTRVGESQSCPELGL
FDFNDANSGSFDLGVRIKAGIKTCIERFEPRLTHLDIRVLHDTSCPFSLRFHIHGKINVK
TAQEKIEIDLFLDSNRTYRVS
NT seq 426 nt   +upstreamnt  +downstreamnt
ttgtttaatcatgacgacacttttggagtgagcttttttcaacgcttaggtgatgaaaat
gagcacgcttcaaatggatctgaatccattgaatatgtcatcgcttcgattaaacgcaat
atctctggcctgctaaatacgcgggtcggagagtctcaaagttgtcctgaacttggattg
tttgattttaatgacgccaattcaggaagctttgatttaggcgttaggatcaaagcaggc
ataaagacatgcattgagcgtttcgaaccgcgactcactcatttagatattcgtgttttg
cacgatactagttgtccattcagtttgcgatttcatatccacggaaaaattaacgttaaa
acggctcaggaaaagatcgaaatagatctctttttggatagtaaccgaacgtatagggta
agttag

DBGET integrated database retrieval system