KEGG   Shewanella woodyi: Swoo_2528
Entry
Swoo_2528         CDS       T00676                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swd02044]
    Swoo_2528
Secretion system [BR:swd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Swoo_2528
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ACA86805
UniProt: B1KGT6
Position
complement(3089487..3090962)
AA seq 491 aa
MESMETAQESSQVLNGNLLDEILAQTKITPIDEGYDVAKKGVAAFISNILETESNSEPIN
KALVDKMLVELDKKISSQMDQILHDESVQQMESSWRNLKLLVDRTDFRENIKIEVLHVTK
SELLDDFEFAPETVQSGLYKHVYSSGYGQFGGEPIGAIVGNYAFTPSSQDMKLLQYVSAV
GAMAHAPFLSSVGPEFFGIDSFEELPNLKDLKSTFESPKYTKWRSLRESEDARYLGLTAP
RFLLRVPYDPIDNPIGSFNYRESVHASHEDYLWGNTAFALATRLTESFAKYRWCPNIIGP
QSGGAVDDLPVHVFESMGALQSKIPTEVLITDRKEFELADEGFISLTMRKGSDNAAFFSA
NSIQKPKVFPNTKEGKEAETNYKLGTQIPYMMIINRLAHYIKVLQREQIGSWKERQDLER
ELNSWIKQFVADQENPPADVRSRRPLRAAKVEVMDVQGDPGWYQVSMAVRPHFKYMGANF
ELSLVGRLDQE
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggaatcaatggaaacagcgcaggaaagtagtcaggtattaaatggtaatcttctagat
gagattttggctcaaaccaagataacacctatcgatgaaggctatgatgttgctaaaaaa
ggggtcgctgcctttatcagcaatattcttgaaacagaatctaacagcgagcctatcaat
aaagcgcttgttgataaaatgctggtcgagttagataaaaagattagtagtcagatggat
caaattcttcatgatgaatctgttcaacagatggagtcatcgtggagaaatttaaagtta
ttagttgatagaactgactttagagaaaatataaagattgaagttctccatgtaacaaaa
agtgagttacttgacgattttgagtttgcaccggaaacggttcaatcgggtctttacaag
cacgtatactcttcgggttatggtcagtttggtggtgagccgataggggctattgtgggt
aattatgcctttacgccatcttctcaagatatgaagctgttgcagtatgtctcagcggtt
ggcgcgatggctcatgcacctttcttatcctccgttggccctgagttttttggtattgat
tcgtttgaagagttaccgaatttaaaagatctaaaatcaacatttgaaagccctaaatac
actaagtggcgctcattaagagagtctgaagatgcaaggtacttggggctaacagcgcct
agattcctactgcgtgttccctatgatcctattgataacccaattggttcatttaactat
cgtgaaagtgttcatgcaagccacgaagattacctttggggtaacacagcatttgcttta
gcaacacgattgaccgaaagcttcgctaagtaccgctggtgcccaaatattattggccca
caaagcggtggcgccgttgacgatcttcctgttcatgtctttgaatcgatgggggcactg
cagtcaaaaattccgacagaagtactcatcaccgatcgcaaagagtttgaacttgctgac
gaaggttttattagccttaccatgcgcaaaggtagcgacaatgcagcgtttttctcagct
aactcaatccaaaagccaaaagtgtttccgaataccaaagagggcaaggaggctgagacc
aactacaagttaggcactcagatcccttacatgatgattatcaatcgtctagctcactac
attaaggtattgcagcgtgagcagatcggttcatggaaagagcgtcaagatcttgagcga
gagctcaatagttggattaaacagtttgtcgctgatcaggaaaatccaccagcagatgtc
agaagccgtagaccactacgtgcagctaaagtcgaagtgatggatgtacagggcgatcca
ggatggtatcaggtctcgatggcggttcgaccgcacttcaaatacatgggagctaacttc
gaactctctttggttggacgtctagaccaggagtaa

DBGET integrated database retrieval system