KEGG   Shewanella woodyi: Swoo_2916Help
Entry
Swoo_2916         CDS       T00676                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swd  Shewanella woodyi
Pathway
swd00260  Glycine, serine and threonine metabolism
swd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01130  Biosynthesis of antibiotics
swd01230  Biosynthesis of amino acids
Module
swd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swoo_2916
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swoo_2916
Enzymes [BR:swd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swoo_2916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACA87189
UniProt: B1KK02
Position
3565360..3566583
Genome map
AA seq 407 aa AA seqDB search
MTKLDPYFGEYGGMYVPQILMPALKQLETAFVEAQEDEAFKTEFNDLLKNYAGRPTALTL
TRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSSTLKDACNEAMRDWSGSY
DKAHYLLGTAAGPHPFPTIVREFQRMIGAETKKQILEREGRLPDAVIACVGGGSNAIGMF
ADFIDEESVKLIGVEPAGLGIDTPMHGAPLKHGKTGIFFGMKAPLMQDREGQIEESYSIS
AGLDFPSVGPQHAHLAATGRATYESATDDEALEAFQLLARSEGIIPALESAHALAYAVKM
AKAATQETILVVNLSGRGDKDIFTVADILEERERSQTGQQKEESGND
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgactaagctcgacccctatttcggcgaatatggcggcatgtatgtgcctcaaatttta
atgccagcactcaagcaacttgaaacagcatttgttgaagctcaggaagatgaagcattt
aaaactgaatttaacgatctgctaaaaaattacgctggccgtcctacagcgctcacctta
actcgtaatttaagtcctaaccctttagtgaaaatttacctaaagcgtgaagatctcctt
catggtggcgctcacaaaacaaaccaagtattaggtcaagctctgcttgcaaagcgtatg
ggtaagaaagagatcatcgccgaaactggtgctggtcaacatggagttgcaaccgctctt
gcttgtgcgcttcttgacttaaaatgtaaggtttacatgggcgcaaaagatgttgagcgc
caatcgcctaatgtgttcagaatgaagctgatgggtgctgaagtgatcccagtaacatca
ggctcctccaccctaaaagatgcctgtaatgaggcgatgcgcgactggtcaggtagctat
gataaggcccattatctactgggaaccgcagcaggaccacaccctttcccgacgattgtt
cgcgaatttcagagaatgattggtgctgaaacgaagaagcagattctagagcgcgagggt
cgtctacctgatgcggttatcgcctgcgtcggcggtggttctaatgccatcggcatgttt
gccgactttattgatgaagagtctgtcaaattaattggtgttgaacctgcaggtttaggt
attgataccccaatgcacggcgcgccacttaagcatggtaaaaccggaatattcttcggt
atgaaagccccattgatgcaagatagggagggacaaattgaggagtcctactcaatctca
gcaggcctcgacttcccatcagtgggtccacaacatgcccatttggctgccacaggccgt
gcaacctatgagtcggccaccgatgatgaagcattagaagcgttccagctactagcacga
agtgaggggatcatccctgcattagagtctgcccatgcactcgcttacgccgtcaaaatg
gcaaaagccgcaacacaggagaccatattggtggtgaacttatcgggtcgaggcgataaa
gatatctttaccgttgctgatattttagaggagcgcgagaggtcacaaacgggccagcaa
aaagaggagagtggcaatgactga

DBGET integrated database retrieval system