KEGG   Shewanella woodyi: Swoo_3202Help
Entry
Swoo_3202         CDS       T00676                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
swd  Shewanella woodyi
Pathway
swd00071  Fatty acid degradation
swd00072  Synthesis and degradation of ketone bodies
swd00280  Valine, leucine and isoleucine degradation
swd00310  Lysine degradation
swd00362  Benzoate degradation
swd00380  Tryptophan metabolism
swd00620  Pyruvate metabolism
swd00630  Glyoxylate and dicarboxylate metabolism
swd00640  Propanoate metabolism
swd00650  Butanoate metabolism
swd00900  Terpenoid backbone biosynthesis
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01200  Carbon metabolism
swd01212  Fatty acid metabolism
swd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swoo_3202
   00630 Glyoxylate and dicarboxylate metabolism
    Swoo_3202
   00640 Propanoate metabolism
    Swoo_3202
   00650 Butanoate metabolism
    Swoo_3202
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Swoo_3202
   00072 Synthesis and degradation of ketone bodies
    Swoo_3202
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Swoo_3202
   00310 Lysine degradation
    Swoo_3202
   00380 Tryptophan metabolism
    Swoo_3202
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Swoo_3202
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Swoo_3202
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Swoo_3202
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:swd04147]
    Swoo_3202
Enzymes [BR:swd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Swoo_3202
Exosome [BR:swd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Swoo_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACA87472
UniProt: B1KMU4
Position
complement(3930451..3931653)
Genome map
AA seq 400 aa AA seqDB search
MEWKMSTEQLSQEIVIVAAKRTPMGGFQGALSTVPSPKLAATAIKGLITQTGVSVDAVDE
VLMGCVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAGIV
VAGGMESMSQAPYLLDKARGGMRMGHGKVMDHMFLDGLEDAYTGGAMGTFAQKTADDFKL
TREQMDAFSLSSLEKANKAIETGAFNDEITPVTVESRRGDTIVEIDEQPGNARPDKIPTL
RPAFTKDGTITAANSSSISDGAAALMLMTAQQANVLGLPVLATIKGHTTHAQEPSMFTTA
PVGAMNKLFEKVNWSVDDVDLFEINEAFAMVTMLAISELSIDADKVNVNGGACALGHPIG
CSGARVLVTLIHALHARGLKRGVASLCIGGGESTAMAIEI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaaaatgagtactgagcaattgagtcaagagatcgtgattgtagccgccaag
cgaacccctatgggaggctttcaaggcgcattgtcgacggttccatctccaaaactggcg
gccacagccattaaaggtttgataacacaaactggtgtttctgttgatgctgtcgatgaa
gtgttgatggggtgtgtgcttccagcgggccttggtcaagcgccagctcgtcaagcaaca
ttgggggcgggactgccgctgtcagttggtgcaacgactgtcaataaggtgtgtggctca
ggcatgaagactgtgatgctagcacacgaccttattaaagcgggcagtgctggtatcgtt
gttgctggtggtatggagagcatgagtcaagcaccttacttgctagataaagcccgtggc
ggtatgcgtatgggtcatggcaaggtgatggatcatatgttcctcgatggcctagaagat
gcttacactggcggcgcaatgggcacatttgctcaaaagacggctgatgattttaaactt
acccgtgaacagatggatgccttttcactaagctcactcgagaaagccaataaagcgatt
gaaactggcgcctttaacgatgagataacccctgtgacagtagaaagtcgccgtggtgac
actatcgttgagattgatgagcagccaggcaatgcccgtccagacaaaattccaactcta
cgtccagctttcactaaagatggcaccatcactgcggccaactcaagctcaatctctgac
ggagctgcggctctgatgttgatgacggctcaacaagcaaatgtgcttggcttacctgtt
cttgcgacgattaagggacacactacccacgcacaggagccatccatgttcaccacagcg
ccagtgggcgcgatgaataagctgtttgagaaggtgaactggagtgtcgatgatgtagat
ctatttgagatcaacgaagcctttgccatggtgaccatgcttgccatctctgagctttca
atcgatgcagataaagtgaatgtcaatggtggtgcttgtgcgctgggtcatccgattggt
tgctctggtgctcgcgtattagtcacgcttattcatgcactccatgctcgtggtttaaag
cgtggtgttgcatcgctgtgtattggtggcggcgaatcgacggcaatggcgatagagatt
taa

DBGET integrated database retrieval system