KEGG   Shewanella woodyi: Swoo_3275Help
Entry
Swoo_3275         CDS       T00676                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
swd  Shewanella woodyi
Pathway
swd00900  Terpenoid backbone biosynthesis
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Swoo_3275
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Swoo_3275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NmrA Semialdhyde_dh DapB_N Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ACA87545
UniProt: B1KNT7
Position
complement(4018257..4019444)
Genome map
AA seq 395 aa AA seqDB search
MQSMVILGATGSIGASTLSVIASNPETYSVYALVANTNVDKMMALCEQYRPKVAHMVDEQ
AAKSLQERLSPSLKIEVTTGESQLESIVTSSCVDTVMAAIVGAAGLVPTLAAVKAGKRVL
LANKESLVMSGRLFIEEMKKSGAQVLPVDSEHNAIFQALPEPVQQEIGFCDLDEAGISHI
LLTGSGGPFLTSPLSSLPQMTPAQACKHPNWSMGRKISVDSASMMNKGLEYIEARWLFNA
SAEQLKVVIHPQSVIHSMVQYRDGSVIAQLGNPDMRTPIAHCMSYPQRINSGVEPLDFFK
VGQLSFLEPDFTRFPCLALAIDACNQGQEATTILNAANEISVAAFLDNKIKFTDIAKVNE
TCLSQVAKQALNSIDDILALDVQTRTYASEWVNKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcatggtgattttgggagcgactggctccataggcgctagcacgctcagcgtt
attgccagtaaccctgaaacatattcagtttacgccttagtcgctaatactaatgttgat
aagatgatggctctatgcgaacagtacagacccaaagtcgcgcatatggtcgatgagcag
gctgcaaaatctttgcaggaacgcctgtcaccaagtttaaagattgaggtgacaacaggg
gagtcgcagcttgaaagtattgtgacttcaagctgtgtagatactgtgatggctgcgatt
gttggggcggcaggattggtgcctacgttagcagcggttaaagcgggtaaacgtgtactc
ttggcgaataaagagtcattggtgatgtccggtcgtctctttattgaagagatgaaaaag
tctggtgctcaagtactgcctgttgacagtgaacataacgctatttttcaagcactccct
gagccagtacagcaagagatcggtttctgtgatttagatgaagctgggatctcccatatc
ttgcttacgggatctggaggaccgttcttgacatcaccgttaagctcattgcctcagatg
acacctgctcaggcttgtaaacatcctaattggtccatggggcgcaagatctctgttgat
tcagccagtatgatgaataagggccttgagtatattgaggcgcgctggctatttaatgca
tcggctgagcaactgaaagtagttattcaccctcaaagcgttatccactcgatggttcag
taccgtgatggctctgttatcgctcagttaggcaacccggatatgcgtacaccgattgca
cattgcatgtcctatccacaaagaattaactctggagttgaacctttagactttttcaaa
gtcggacagttaagcttcttagaacctgactttactcgttttccctgtttggcattagca
atcgatgcttgtaaccaaggacaggaagccaccacaatattaaatgcagccaatgaaatt
tcagttgccgcgtttttagataataaaattaagtttaccgatattgctaaagtgaatgaa
acctgtttaagtcaggttgcaaaacaagcactaaacagtattgatgacattttagcattg
gatgtacagactcgtacctatgcttcagaatgggtaaataagatttaa

DBGET integrated database retrieval system