KEGG   Shewanella woodyi: Swoo_3468Help
Entry
Swoo_3468         CDS       T00676                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:swd03009]
    Swoo_3468
Enzymes [BR:swd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Swoo_3468
Ribosome biogenesis [BR:swd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Swoo_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ACA87734
UniProt: B1KQX8
Position
complement(4244002..4245078)
Genome map
AA seq 358 aa AA seqDB search
MINLFLYCRSGYEKECAAEIQHRAAELEIGGFVKTNKKDGYVIFQCFQAGDANILAQKIK
LDSLIFARQMFAAKELLKNLPEHDRITPIMEALSDVRNAGELRVETPDTNEAKERTAFCR
KFTVPLRQKLKNAGNLLKKENSSRPIIHVCFVASGTAYVGFSFSNNSSPYPMGIPRLKMA
SDAPSRSTLKLDEAFIHFIPEEEQEQRLSSGMNAVDLGACPGGWTYQLVRRGMFVAAVDN
GPMDEGLMETGQVKHYQADGFRFEPPRKNIYWLVCDMIEKPSRVAELIEAWAINGWFKEA
MFNLKLPMKSRYQDVSTILETMATVLEENEIKNFSIKCKHLYHDRDEVTVYLSLNPTQ
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacctatttttatattgccgctctggttatgaaaaagagtgtgcagctgagata
caacatcgtgcagctgaactcgaaattggtggttttgttaaaaccaacaaaaaagacggc
tatgtgattttccagtgttttcaagccggtgatgcaaatatcttggcacaaaaaattaaa
ttggattcactgatttttgccagacagatgtttgccgctaaagagctgctgaaaaatcta
cctgaacatgatcggatcacaccgattatggaagcgttatccgatgtcaggaatgcgggt
gagttaagggttgaaacacccgataccaatgaagctaaagagcgcacggctttttgtcgt
aaatttacggttcctttaagacagaagctaaaaaacgctggcaacttacttaaaaaagag
aatagcagtcgacctattatacatgtctgttttgtggcatcgggcacggcttacgtgggc
ttctcttttagtaacaatagctctccctatccgatggggatccctaggctaaaaatggcc
agcgatgcaccgagtcgttcgacgcttaaactcgatgaagcctttatccactttattccc
gaagaggagcaggagcagagattaagcagtggcatgaatgccgtcgacttaggtgcttgt
ccaggtggctggacgtatcagttagtgcgtcgcggtatgtttgtggccgctgtggacaat
ggacctatggatgaaggtttgatggagactgggcaggtaaaacactatcaagccgatggt
tttcgttttgagccgccacgtaaaaatatctactggttagtgtgtgacatgattgagaag
ccatctcgtgtggcagagctgattgaagcttgggcgatcaatggctggtttaaagaggcg
atgtttaacctcaagctgccgatgaagagtcgctatcaagatgtctcgacgatattagag
accatggcgactgtacttgaggagaacgagattaagaacttctctatcaagtgtaagcac
ctctaccatgatcgtgatgaagtgactgtgtatttgagtcttaacccgactcaatag

DBGET integrated database retrieval system