KEGG   Shewanella woodyi: Swoo_3941Help
Entry
Swoo_3941         CDS       T00676                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
swd  Shewanella woodyi
Pathway
swd00511  Other glycan degradation
swd00520  Amino sugar and nucleotide sugar metabolism
swd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Swoo_3941
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Swoo_3941
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:swd03110]
    Swoo_3941
Enzymes [BR:swd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Swoo_3941
Chaperones and folding catalysts [BR:swd03110]
 Intramolecular chaperones
  Others
   Swoo_3941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ACA88198
UniProt: B1KFM3
Position
4805214..4807649
Genome map
AA seq 811 aa AA seqDB search
MWQQLVIFLNSVLLVSVCINANAKPINIMPLPAELKIAPDSTHFHISPALSFATSGIPDN
NALQFKQTMQELLAARIQTNLTLNSINDDVKSSDKPDVLVKLTQQPLNRPPQLGDDESYE
LDISSTQLTLIASNELGIKHGLNTLSQLLLTTPQGIGKADIPAIVIKDKPRYPWRGLLID
SVRHFMPIETIKRQLDGMASAKLNVFHWHLTDDQGWRIESKIYPALHQKASDGKFYTQAE
ITSIVEYASHKGIRVVPELDLPGHASAIAVAYPELMSAEGPYEMERQWGVFEPILDPTNP
EVYQFIDKLVGELTTLFPDHYLHIGGDEVPPTQWLNNESITEYMQKNALLNAEDLQAHFN
QKVNKILAQHKRFMMGWDEIFHPKLPSDILVQSWRGLDSLSQITAAGYQGLLSTGFYIDQ
AQYTDYHYRNDPQSEPAPLVALLPADVQGEVWQFTMPRYKGSPIHGELLIVHDSQPYAYL
SLNGKLSKKVNKLILSENKIEYRIDTWMGPTTAEFTISNDTVLAGHIFVGNTLYPITGQR
SALAQASQLTKAKLKQAPVELIADHNKVLGGEATIWSELITHENIDIRVWPRLYAIAERL
WSPKELTDSQNMYQRLASISSYSQRYIGLEHKQQQQQGLQNLVAQNSDISPLQLLAETVE
PAHYYTRHHLKFQANEYHQQAPLNRFVDYLDVESLPLIFLHQGLAKAKDKESLEFANALN
LIETALLKWQKNQPRLKQLIDQSPKLHSIKQVAELNDKTLNLGIELVKLCRNNSLTELSA
LDDELISILSYKGEVVLASAHLLRELIRRCR
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaacaactggtaatttttctaaatagtgtcctcttggtgtcagtttgcataaat
gcaaatgccaaacctattaatattatgccgcttccagccgagctaaaaatagctcccgac
tcaactcattttcatatctctccagcgctatcatttgccacctctggtatccctgataac
aatgcgctgcaatttaaacaaaccatgcaagagctcttagcagccagaatccaaacgaat
ttaacactcaactccatcaatgacgatgtcaaaagtagtgataagccagatgttctagtt
aaactgacgcagcaaccactaaaccgtccacctcaactcggtgatgatgaaagttatgag
ctagatatcagctcaacacagctcacccttattgctagcaatgagctaggtatcaaacat
gggcttaacactctcagccagctactactaacgacaccgcaggggataggtaaagcagat
atccctgcgatcgtgataaaagataaacctcgttatccttggcgcggcttgctgattgat
agtgtgcgtcactttatgccaattgaaaccattaagcgtcaactcgacggtatggcttcg
gcaaagctcaatgtttttcattggcacctaactgacgatcaaggctggaggatcgaatca
aaaatctacccagcactgcatcaaaaggcatctgatggaaagttctatactcaagctgag
ataacctcgattgttgagtacgcctctcacaaagggatccgtgtagtgccagagttagat
ctaccagggcatgcttcagcaatcgcggtggcctatccagagttaatgagcgcagaaggc
ccctatgaaatggagcggcaatggggggtatttgagcctattctcgatcctacaaacccc
gaggtttatcagtttatcgataaactagtcggtgagttgaccactctttttcccgatcat
tacttgcatataggcggcgatgaggtcccaccgactcagtggctcaataatgaaagtatc
acagagtatatgcaaaagaatgcgttgcttaatgcagaagatcttcaggcacactttaat
caaaaagtgaataagatcttggctcaacacaaacgatttatgatgggctgggatgagata
tttcatcctaaattaccttcagatatattggtacagtcatggcgtgggctcgactcactt
tcgcaaattaccgccgctggatatcaaggcttgctctcaacaggcttttatatcgatcag
gcacaatatactgactatcactatcgcaatgacccacaaagtgagcccgcccccttagta
gccttattgcccgcagatgttcagggcgaggtatggcaatttactatgccaaggtataaa
ggctctcctattcatggtgagttattgattgttcacgatagccaaccctatgcttacctg
agcctcaacgggaaattatccaaaaaagtcaataaactcatactctcagagaataagatt
gagtaccgtatagatacctggatggggccaaccacagcggagttcaccatatcgaacgac
actgttttagccgggcacatatttgtcggcaacacgctttacccaatcacaggacaacgc
tcagcgctagctcaggcaagtcagttaactaaagcaaaattaaaacaagctcctgtagag
ctcattgctgatcataataaggttttaggtggtgaggcgacgatatggtctgagcttatc
acccatgaaaatatcgacatcagagtctggccacgactatatgctatcgctgagcgtttg
tggtcgccaaaagagctcaccgatagtcaaaatatgtatcaacgtttagcttcaataagc
agctatagccagcgctatatcggccttgaacataaacagcagcaacagcaagggctacaa
aacttagtcgctcaaaatagcgacatatcgcctttacaactgctggctgaaacggtggaa
cctgcacactactacactcgccaccacctcaaatttcaagccaatgagtatcatcagcaa
gcgccactgaatcgatttgtggactaccttgatgttgagagcctgccattgattttttta
catcaagggttagcgaaggcaaaagataaggagagtctagagttcgccaatgctctaaat
ctgattgagacagcactgctaaagtggcaaaaaaatcaaccaaggttaaagcaactcatt
gaccaatcgcccaagttacacagtatcaagcaggtagcagagctaaatgataaaaccctc
aacttaggcatcgaactagttaaactatgccgcaacaacagcttaactgaacttagtgcc
ctagatgatgagttaatctcaatcttgtcttataaaggagaggttgtcctagcatcggct
cacttgctacgcgaactgataaggagatgtcgctaa

DBGET integrated database retrieval system