KEGG   Shewanella woodyi: Swoo_4081Help
Entry
Swoo_4081         CDS       T00676                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
swd  Shewanella woodyi
Pathway
swd00860  Porphyrin and chlorophyll metabolism
swd01100  Metabolic pathways
Module
swd_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Swoo_4081
Enzymes [BR:swd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Swoo_4081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: ACA88337
UniProt: B1KH25
Position
complement(4952392..4953975)
Genome map
AA seq 527 aa AA seqDB search
MSPKKKIESDTAVPAQVLMVQGTTSDAGKSTLVAGLCRLFARRGVNVAPFKPQNMALNSA
VTADGGEIGRAQALQAIACGLPLHTDFNPILLKPSSDTGAQVIVQGRALDQMEAKTFFGQ
DGERIKEKGGYRVKAMSAVLDSFERLSRGYDTLFVEGAGSPAEINLREGDIANMGFAEAV
DCPVIIIADIDKGGVFAHMVGTLALLSESEQARVKGFVINRFRGDIALLQSGLDWLEFYT
NKPVLGVLPYLHDLHLDAEDALVASPVKSQNSKLNVLVLVFPRISNHTDFDPLRLHPQIE
FNYVSVQTLSQSPLTSGELPQADLIILPGSKNVRADLDFMREQGWDIALAKHLRYGGKVM
GICGGYQMLGLMIDDPSGVEGEVGDTEGLGYLSLVTELKPDKVLRQVTGELSLLGEQAAV
KGYEIHCGESQILNPDLSQNSPFSLTVESEAEEFSDGMLTKDNQILGTYLHGVFDSPQAC
TLILKWAGLNHAQVVDIDAIREEQLNRFADQLEKSLDIEKIEEILRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaaaaagaagattgaatcagatacagcagttccagctcaagtgcttatggta
cagggtaccacttcagatgccggcaaaagcaccttagtcgcaggtttgtgccgtttgttt
gcccgtcgcggtgttaacgttgctcccttcaagccacaaaatatggcgcttaatagtgcg
gttactgccgatggtggtgagattggccgcgcccaagcgctgcaagcgatagcctgtggt
ttacctctgcacacagattttaaccctattttactcaagcccagttctgatacgggtgct
caagttatcgtgcaaggtcgagccttagatcagatggaagctaagaccttttttggtcaa
gatggcgagcgaataaaagagaaggggggctaccgagtcaaggcgatgtcggcagtactc
gactcctttgagcgtttatctagaggttatgacactttgtttgtagagggtgctggtagc
cctgctgagattaatctgcgtgaaggtgatattgctaatatgggctttgccgaagcggta
gattgccctgtgatcatcatagctgatatcgacaaaggtggtgtgtttgctcatatggtt
ggcactctcgcgctgctttctgagtctgagcaggctagggttaaagggtttgtgattaac
cgttttcgcggcgatattgcactgctgcaatctggactcgattggctggagttctacacg
aataaacctgtgttaggtgtgttgccctatttacatgatctgcatttggacgctgaagat
gccttggtggcatcgcctgttaaatcccaaaacagcaagcttaatgtccttgttttagtt
tttcctcgcatcagtaatcacaccgattttgatccccttaggttgcacccgcagattgag
tttaactatgtctcagtgcaaactctgtctcaatctccattaacttctggagaactacct
caagccgatctgatcatactaccgggcagtaaaaatgttcgggctgatctggatttcatg
cgtgagcagggctgggatatcgcgctggctaaacatcttaggtatggtggtaaggtgatg
gggatctgtggcggatatcagatgttaggcttgatgattgacgatcctagtggggttgaa
ggtgaggtgggtgatacagaagggttaggttacctctcactcgtaacagagcttaagcca
gacaaggtgttaagacaggtcactggtgagctctctttgttaggggagcaggcagcagtg
aaaggctacgagatccattgtggcgagtcccaaatattaaatcctgatctgagtcaaaac
tctccgtttagcctcaccgttgagagtgaagctgaagagtttagtgatggcatgctcact
aaagacaaccaaattttaggcacctatcttcatggtgtgtttgactcgcctcaggcttgc
actcttatcctcaaatgggcgggattgaatcatgcccaagtggtggatatcgatgccatc
cgtgaggagcaacttaatcggtttgccgatcagctagagaaaagtttagatatagagaag
atagaagagattttaagatcgtga

DBGET integrated database retrieval system