KEGG   Swingsia sp. F3b2: E3E12_02045Help
Entry
E3E12_02045       CDS       T06093                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
swf  Swingsia sp. F3b2
Pathway
swf00260  Glycine, serine and threonine metabolism
swf01100  Metabolic pathways
swf01110  Biosynthesis of secondary metabolites
swf01120  Microbial metabolism in diverse environments
swf01130  Biosynthesis of antibiotics
swf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:swf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E3E12_02045
Enzymes [BR:swf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     E3E12_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QDH13177
UniProt: A0A4Y6U9R5
Position
467730..468926
Genome map
AA seq 398 aa AA seqDB search
MAAALATKPTPDTLYAEGTVRKDFTSDNVAPVDEAVMAAMVAANQGNATPYGLDPLGSAL
EEKFRQAFGIDVAVFTATTGTAANALSLASLVQPWGSVVCDGAAHIDNDEGGAPEFFTGG
SKIYPLPSHDGRMDPAALKTAMEHNKAKGVLAPPYQALSLTQATEWGTVYTPTQLQALCA
TAHEGDLAVHLDGARLGNALAHLKTRHPATTLAEATWGAGVDVLVFGGTKAGAMAAEAIV
FFLNPQSPAHSQVERAVASMRRQVKRSGHLWSKGRYLSAQLLALLEDGHTAMPRWLANGA
HANQMARQLRAGLDKRSTERGLKLPFATESDELFVVMPTQLANKLAEQGFSFYRFPVPPF
IQSPQRQGQDDIMVRFVTSFYTRPQDVQALLNAFDGDF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcactggcgaccaaacccacccccgacaccctctacgctgaagggacagtc
cgcaaagatttcacaagcgataacgttgcccctgtggacgaagccgtcatggcagccatg
gtggcagccaaccaaggcaatgccaccccctatggtcttgatccgttggggagcgcgctt
gaggaaaagttccgccaagcttttggcatcgatgtggccgtgttcacagccaccactgga
acggcagccaatgccttgagcctggccagcctggttcagccctggggcagcgtggtgtgt
gacggggcagcccacattgataatgacgaggggggggcgcctgaatttttcacagggggg
agcaaaatctatcccctcccgtcccatgatggccgcatggacccagccgctttgaaaacg
gccatggagcataacaaagccaaaggcgttctggcccctccctaccaggcgctttcccta
acgcaagcaacggaatggggcactgtctacaccccaacgcagctgcaggcgctttgcgca
acagcgcatgaaggtgacttggccgttcatctggacggcgcgcgtttgggcaacgccctg
gcccatctgaaaacgcgccaccctgccaccaccttggcggaagccacatggggggcaggg
gtggacgttctggtgtttggcggcaccaaggctggcgccatggcggcggaagccatcgtg
tttttcctcaacccccaaagcccagcccacagccaggttgaacgcgctgtcgcctccatg
cgcaggcaggtgaagcgttctgggcatttgtggtctaaagggcgctacctgtctgctcag
ttgctggccctgctggaggatgggcacacagccatgccccgttggctggccaatggcgcc
catgccaaccaaatggcacgccaattgcgcgcagggttggacaagcgctccactgaacgt
ggcttgaagctgcctttcgctactgaaagtgacgagctattcgttgttatgccaacgcag
cttgccaacaagctggctgaacaggggttcagcttctatcgcttccccgtgccgcctttt
attcaaagtccccagcgccaaggccaagatgacatcatggtgcgtttcgtcaccagcttt
tacacgcgaccccaagacgtccaggctttgctcaatgcttttgacggtgacttttga

DBGET integrated database retrieval system