KEGG   Swingsia sp. F3b2: E3E12_06820Help
Entry
E3E12_06820       CDS       T06093                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
swf  Swingsia sp. F3b2
Pathway
swf00230  Purine metabolism
swf00240  Pyrimidine metabolism
swf01100  Metabolic pathways
swf01110  Biosynthesis of secondary metabolites
swf01130  Biosynthesis of antibiotics
Module
swf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
swf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
swf_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:swf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    E3E12_06820
   00240 Pyrimidine metabolism
    E3E12_06820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:swf04131]
    E3E12_06820
Enzymes [BR:swf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     E3E12_06820
Membrane trafficking [BR:swf04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    E3E12_06820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: QDH13940
UniProt: A0A4Y6UAG9
Position
1558101..1558541
Genome map
AA seq 146 aa AA seqDB search
MPLERTFSIIKPDATRRNLTGEINAVIENNGFAIVGQRRIHMSRAQAEGFYRDHKDQDFF
QALVDYMVSEPVVVQVLEGEDAIKRYRALMGPTDATKAGPDTLRGRFALSMRENSVHGSD
SPANAQREIGYFFSEVEILPCTPEKP
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggagcgcacattttccatcatcaagccagacgcgacccgccgtaacctgacg
ggcgaaatcaacgccgtgatcgagaataacggctttgccattgtggggcagcgccgcatc
cacatgtcgcgcgcccaggctgaaggcttctaccgcgaccacaaggaccaggatttcttc
caagccctggtggattacatggtttcagaacctgttgtggtgcaggtacttgagggggag
gacgccatcaagcgctaccgcgccctgatgggccccacagatgccaccaaggctgggcca
gacacgctgcggggccgctttgccctcagcatgcgtgagaactccgtccatggttcggac
agtcccgccaatgctcagcgtgagatcggctatttcttctctgaggtggagatcctgccc
tgcacgcctgaaaagccctga

DBGET integrated database retrieval system