KEGG   Sphingomonas wittichii: Swit_0669Help
Entry
Swit_0669         CDS       T00538                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
swi  Sphingomonas wittichii
Pathway
swi00010  Glycolysis / Gluconeogenesis
swi00620  Pyruvate metabolism
swi00640  Propanoate metabolism
swi00680  Methane metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_0669
   00620 Pyruvate metabolism
    Swit_0669
   00640 Propanoate metabolism
    Swit_0669
  Energy metabolism
   00680 Methane metabolism
    Swit_0669
Enzymes [BR:swi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Swit_0669
Lipid biosynthesis proteins [BR:swi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Swit_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABQ67036
UniProt: A5V420
Position
725817..727499
Genome map
AA seq 560 aa AA seqDB search
MLLNGDRLQAARDFLIRHRTDHDAAVAGFAWPRFEQFNFAFDWFDRIAERSDAIALSIAS
PRGLRAWSYRDLSLGSNRVAHFLRRHGIGPGDRLLIALGNRIELWETQLAAMKAGCVMVP
CTVMLGAAELRERMARSGARAIVADDSIAERLGTPDKGWIGFNVDAPRPGWIDYGAAYGE
PAGFAPDQPTRGTDPLLIYFTSGTTAQPKMVTHSHVSYPVGHLSTLYWIGLKPGDTHLNI
SSPGWAKHAWSSFYAPWLAEASILTIDQPAFDARFVLDQIRDRAVDCFCAPPTVWRMLLQ
ERIEQWPVRLREAVSAGEPLNPHVVERVREVWGIDVRDGYGQTETTAQIGNTPGQPLVAG
AMGRPLPGFRIELDGAADHGEIILHAGDMAAGVMLGLQAEAGSAVLPPSGGIHRTGDIAS
AAPDGTLTYIGRADDVFKSSDYRISPFEIESVLLEHPAVAESAVIPSPEPTRLAVPKAII
VLAPGHAPSAETAAEIFAHSRARLAPYKRIRRLEFGELPKTVSGKTRRAELREREDGGRS
EGEYREEDFATTAKSGSRSG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgctattgaacggagacaggttgcaggccgcgcgggactttctcatccggcatcgcacc
gatcatgacgccgcggtagccggcttcgcctggccgcgcttcgagcagttcaacttcgcc
ttcgactggttcgatcggatcgccgagcgcagcgatgcgatcgcgctgtcgatcgccagc
ccccgaggcctccgtgcctggtcctaccgcgacctgtccctcggctcgaaccgtgtcgcg
catttcctgcgccgccatgggatcggccccggcgatcgactgctgatcgcgctcggcaac
cggatcgaactctgggaaacgcagctcgccgcgatgaaggccggctgcgtgatggtgccc
tgcacggtgatgctgggggcagccgaactgcgcgagcgcatggcccgcagcggcgcgcgc
gcaatcgtcgccgacgacagcatagccgaacgcctgggcacgcccgataagggctggatc
ggcttcaacgtcgacgccccccgccccggctggatcgattatggcgcggcttatggcgag
ccggccggcttcgcgccggatcagccgacacgcggcaccgatccgctgctgatctacttc
acctccggcaccacggcgcagccgaagatggtgacgcacagccatgtttcctatccggtc
ggccatctgtcgacgctctactggatcgggctgaaacccggcgatacgcatctcaacatc
tcgtcgcctggctgggccaaacatgcctggagcagtttctacgcgccctggctcgccgag
gcatcgatcctgacgatcgaccagcccgccttcgacgcgcgcttcgtgctcgatcaaatc
cgcgatcgcgcggtggactgtttctgcgcgccgccgacggtgtggcgcatgctgctgcag
gagaggatcgagcaatggcccgtccgcctgcgcgaagcggtcagcgccggcgaaccgctg
aacccgcatgtggtggagcgcgtccgcgaagtctggggtatcgacgtgcgcgacggctat
ggccaaaccgagacgaccgcccagatcggcaatacgccgggccagccgctggtcgccggc
gcgatgggccgtccgctgcccggcttccgcatcgaactcgacggcgccgccgaccatggc
gagatcatcctgcacgccggggacatggccgcgggggtgatgctcgggctgcaggccgaa
gccggcagcgcggtcctgccgccatctggcggtatccaccggaccggcgacatcgcctcc
gccgcaccggacggcacgctgacctatatcggccgcgccgacgatgtcttcaaatcgagc
gactacaggatcagccccttcgaaatcgagagcgtcctgctggaacatccggcagtagcc
gaatccgccgtcatccccagccccgagccaacccgcctggcggtgcccaaggcgatcatc
gtcctggcgccgggccatgccccctcggccgaaaccgccgcggagattttcgcacacagt
cgcgcccgcctggcgccctataagcggatcaggcgactggaattcggcgagctgccgaag
acggtttcgggcaagacgcgtcgcgccgaattgcgcgagcgagaagatggcggccggtcc
gagggcgaatatcgggaggaggatttcgccactacagcgaagagcgggtctcgatcaggt
tga

DBGET integrated database retrieval system