KEGG   Sphingomonas wittichii: Swit_1038Help
Entry
Swit_1038         CDS       T00538                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
swi  Sphingomonas wittichii
Pathway
swi00010  Glycolysis / Gluconeogenesis
swi00020  Citrate cycle (TCA cycle)
swi00620  Pyruvate metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
Module
swi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_1038
   00020 Citrate cycle (TCA cycle)
    Swit_1038
   00620 Pyruvate metabolism
    Swit_1038
Enzymes [BR:swi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Swit_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABQ67404
UniProt: A5V538
Position
complement(1155542..1156732)
Genome map
AA seq 396 aa AA seqDB search
MSDRASSGAGAPIVMPKLGLTMAEGLIAEWKVAPGEAVSAGQVLFVVETDKISNEIEAPA
DGTILSLLAEEGATVAVGAPVATWTGPGQGTGGTEQPPAPLSEPVGAPPVAAPARGERRL
STPFARRLAQQAGIDLADVGGSGARGRIKARDVQAAIDRRTTAPAVSAPAPRGRDLRALI
AARVTRSKAEIPHFYLSADARFDALAALRREVNADPSSPGKLSVTAFLGAAVGRALALHP
EANGVWRGDRVEPLDAIAIGIAVEAPGGVMAPVVPLGGGIHDFASALDAAIERARQGRLG
AADVGAAAIGISNVGMFAVRSLTPIIDPDQSFMLGVGAPRAAFRADENGAPVAVRKVTLT
LACDHRAIDGAAAARFLATIVELIEHPVRLLLPIRS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccgcgcgagcagcggcgccggcgcgccgatcgtcatgcccaagctcggcctg
accatggccgaggggctgatcgccgaatggaaggtcgcgcccggcgaggcggtcagcgcc
ggccaggtcctgttcgtcgtcgagaccgacaagatcagcaacgagatcgaggcccccgcc
gacggcaccatcctcagcttgctggccgaggaaggcgcgacggtcgcggtcggcgcgccg
gtcgcgacctggaccgggccggggcaggggaccggcgggaccgagcagcctcccgcgccc
ctatccgaacccgtcggcgcgcctccggttgccgcaccggcgcggggcgagcgccggctc
tccacgccctttgcccggcggctggcgcagcaggcggggatcgaccttgccgatgtcggc
ggcagcggcgcgcgcgggcggatcaaggcgcgcgacgtgcaggcggcgatcgatcgacgg
acgacggctcccgccgtttccgctcccgcgccgcgcgggcgcgatctgcgcgcgctgatc
gccgcgcgggtgacgcgcagcaaggcggagatcccgcatttctacctgtcggccgatgcg
cgcttcgacgcgctggcggcgctgcgccgcgaggtcaacgccgatccgtcgagcccaggc
aagctgagcgtcaccgccttcctcggcgccgcggtcggccgcgcgctggcgcttcatccc
gaggccaatggcgtgtggcgcggcgaccgcgtcgagccgctcgacgccatcgcgatcggt
atcgcggtcgaggcgccgggcggggtgatggcgccggtcgtgccgctcggcggcggcatc
catgatttcgcgagcgcgctcgacgcggcgatcgagcgcgcccggcaggggcggctcggg
gccgccgacgtcggcgcggcggcgatcggcatctccaatgtcggcatgttcgccgtccgc
tcgctcaccccgatcatcgacccggaccagagcttcatgctcggcgtcggcgcgccgcgc
gccgccttccgcgccgacgagaatggcgcgccggtcgcggtgcggaaggtgacgctcacc
ctcgcctgcgaccatcgcgcgatcgacggggcggcggcggcgcgtttcctggcgacgatc
gtcgaactgatcgagcatccggtgcggctgctccttcccatccggtcatga

DBGET integrated database retrieval system