KEGG   Sphingomonas wittichii: Swit_1097Help
Entry
Swit_1097         CDS       T00538                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
swi  Sphingomonas wittichii
Brite
Enzymes [BR:swi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Swit_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT PGM_PMM_II ACP_syn_III_C RrnaAD Gcd10p
Motif
Other DBs
NCBI-ProteinID: ABQ67463
UniProt: A5V597
Position
complement(1232360..1233004)
Genome map
AA seq 214 aa AA seqDB search
MTEQNFEQMRHAMVVSQLRTTGVSDARVVAAMGEVARERFVGADKAAVAYADLPLPIAPG
RALNPPMVTGRLLTQAQVAPGDSALVVGAATGYTAALLERLGASVVAVEEDADLLAAGKA
AVPGATWIKAAPASGSKKGAPYSLIVIDGAVEQIPQALIDQLADGGRLVGALIDNGVSRL
VSGVRVGGGFGVTAFADADAATLPGFGVPAAFSF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacagaatttcgagcaaatgcggcatgccatggtggtgagccagcttcgcacc
accggcgtcagcgacgcgcgcgtcgtcgcggcgatgggtgaggttgcgcgcgagcgcttc
gtcggggcggacaaggcggcggtcgcctatgccgatctgccgctgccgatcgcgccgggc
cgcgcgctcaacccgccgatggtgacgggccgcctgctcacccaggcgcaggtcgcgccc
ggcgacagcgcgctcgtcgtcggcgcggcgaccggctacaccgccgcgctgctcgaaagg
ctcggcgccagcgtcgtcgcggtcgaggaggatgccgatctgctcgcggccggcaaggcg
gccgttccgggcgcgacctggatcaaggcggcacccgcctcgggcagcaagaagggcgct
ccctattcgctgatcgtgatcgacggcgcggtcgagcagattccgcaggcgctgatcgac
cagctcgccgacggcggccgcctggtcggcgcgctgatcgacaatggcgtctcccggctg
gtgtcgggcgtgcgcgtgggcggcggcttcggcgtcacggctttcgccgacgcggatgcc
gccacgctgccggggttcggggtgcccgccgccttcagcttctga

DBGET integrated database retrieval system