KEGG   Sphingomonas wittichii: Swit_1311Help
Entry
Swit_1311         CDS       T00538                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
swi  Sphingomonas wittichii
Pathway
swi00020  Citrate cycle (TCA cycle)
swi00190  Oxidative phosphorylation
swi00650  Butanoate metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
Module
swi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
swi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Swit_1311
   00650 Butanoate metabolism
    Swit_1311
  Energy metabolism
   00190 Oxidative phosphorylation
    Swit_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABQ67676
UniProt: A5V5W0
Position
complement(1467936..1468325)
Genome map
AA seq 129 aa AA seqDB search
MGNGTGIGRVRGLGSAKHGAMHWWRQRVTAAGNLLLATWFVVSLFRLPNLGHDVVVQWIG
SPIVAVPLVLLTVSVFYHMRLGLQVVLEDYVHEDAGKVFSLLLLNLYTIAGAALAIFSIL
KIAFGGVSA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacggaaccggaatcggccgcgtccgcggcctcggctcggccaagcatggcgcg
atgcactggtggcgccagcgggtgacggcggcgggcaacctgctgctcgccacctggttc
gtcgtctcgctgttccgcctgcccaacctcgggcacgacgtggtggtgcagtggatcggc
tcgccgatcgtggcggtgccgctggtcctgctgaccgtctcggtcttctaccacatgcgg
ctgggcctccaggtcgtcctcgaggactatgtccatgaggatgccggcaaggtcttctcc
ctgctgctgctcaacctctacacgatcgcaggcgccgcgctggcgatcttctcgatcctc
aagatcgccttcgggggagtttcggcctaa

DBGET integrated database retrieval system